Details for Chinese cabbage Locus Brara.E02971

Position : A05 ( 5`- 25028715 .. 25029029 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02971

Protein [Map View]
MRTLTGVSPPFQFSPLSVVSFGSTVIAEGCDAASSVSWIHAWTVSHGVITQVREYSNTSLTVTRIGSVVAGRSAEIRASH
CPSVWESKFSGRAGKSVPGLVLAI*

DNA
ATGCGCACGCTCACCGGCGTCTCTCCGCCGTTTCAATTCTCGCCTCTCTCCGTCGTCTCCTTCGGGTCCACCGTCATCGC
CGAGGGCTGCGACGCCGCCAGCTCCGTCTCCTGGATCCACGCCTGGACCGTGTCGCATGGGGTGATCACTCAGGTGAGGG
AGTACTCGAACACCTCGCTCACGGTTACAAGGATCGGCAGCGTCGTCGCCGGGCGCTCAGCGGAGATCAGGGCGTCGCAT
TGCCCCTCCGTGTGGGAAAGCAAATTCTCGGGTCGGGCGGGAAAGTCCGTTCCGGGTCTGGTTCTTGCGATTTGA