Details for Chinese cabbage Locus Brara.E02970

Position : A05 ( 5`- 25021825 .. 25023507 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02970

Protein [Map View]
MSVRKLQKGDLCGVIFGCKFSTIKECHAKNLFGLPGPHMAYIKNIEPGLTLFLFNYSDRTLHGVFEAASEGKLNIDPKAW
SHNGIDPSPYPAQVKVRVRVKCEPLSEETFGPAIADNYKDEKIFWFELDRVQTNKLLRLFKPSTSKHVVASPSSSSRKAI
PAASLVEIGDSGGAPRVDKWSSLFKQDSKDGKTKECEVAQKHVSQSGPSYSSVLRNAISESSARREAPSQASKGVLSSRQ
DVIVNTCEQQRFHATQNGTSAKAKNVIGPSKGSSGEDAYSEIDWDAASNFQAHLKGLNMILEDKDGYKSFDQGNNTGFAS
SSSMMQNDWEDERVSWEYEEENNIDKSSCGSSYVTAMSGDAFEYNGEEKEKLCMDVLREIWAEVKEMKQTQMKQAEYMIS
LQMDLLESRKEILRLKGLYGSS*

DNA
ATGTCTGTGAGGAAGCTTCAGAAGGGAGATCTCTGCGGTGTCATATTTGGATGCAAGTTCAGCACTATCAAAGAGTGTCA
CGCTAAGAACTTGTTTGGCTTACCAGGCCCTCACATGGCTTACATCAAGAACATTGAACCTGGTCTGACGCTGTTCTTGT
TCAACTACAGCGATAGAACACTTCACGGTGTCTTTGAAGCCGCGAGTGAAGGAAAGCTGAACATTGATCCCAAAGCTTGG
TCTCATAATGGGATAGATCCAAGTCCGTACCCTGCTCAGGTAAAGGTACGTGTCCGAGTGAAGTGTGAGCCTCTGTCTGA
AGAAACGTTTGGACCAGCGATTGCTGATAATTACAAGGATGAGAAGATCTTTTGGTTTGAACTTGACCGAGTTCAGACAA
ACAAGCTGCTACGTTTGTTTAAACCATCAACATCCAAACATGTTGTAGCATCACCATCATCATCGTCTAGAAAGGCTATT
CCAGCAGCTTCTCTTGTGGAGATAGGTGACTCAGGAGGAGCGCCACGTGTTGACAAGTGGAGCAGTCTTTTTAAACAAGA
CTCAAAAGATGGAAAAACTAAAGAATGTGAAGTAGCACAAAAACATGTGTCACAATCTGGTCCAAGTTACTCATCAGTTC
TGAGAAATGCGATCAGTGAATCTTCAGCTAGACGTGAAGCTCCATCACAAGCAAGTAAAGGAGTTTTGTCCTCACGCCAA
GATGTCATAGTGAACACTTGTGAACAACAAAGATTCCATGCAACACAGAATGGGACTTCAGCTAAGGCTAAGAATGTAAT
AGGACCTAGCAAGGGAAGTTCTGGTGAGGATGCATATTCAGAGATTGACTGGGATGCTGCATCTAACTTTCAAGCCCATC
TGAAAGGACTCAACATGATTTTGGAGGATAAGGATGGTTACAAGAGTTTTGATCAGGGTAACAACACAGGATTTGCTTCT
TCTTCTTCAATGATGCAAAATGATTGGGAAGATGAGAGGGTGTCTTGGGAATATGAGGAAGAGAATAATATAGATAAATC
ATCGTGTGGGTCCTCGTATGTTACCGCCATGTCAGGGGACGCATTTGAATACAATGGAGAAGAGAAAGAGAAGCTTTGTA
TGGATGTCTTGCGTGAGATATGGGCGGAAGTGAAAGAGATGAAACAAACTCAGATGAAACAAGCTGAGTATATGATCTCT
TTGCAGATGGATCTGCTTGAGTCAAGAAAAGAGATACTTCGACTGAAAGGGCTATATGGAAGTTCTTAA