Details for Chinese cabbage Locus Brara.E02967

Position : A05 ( 5`- 25013038 .. 25014747 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02967

Protein [Map View]
MLLKASPALSILNSGVGDLFPPSNVLFPSTTCRGSRLSVRAAKGTSTKSLTGVVFEPFEEVKKDMDLLVPTTPLTSLARH
KFSDESESAVNEQINVEYNVSYIYHALYAYFDRDNVGLKGFANFFKDSSTEERGHAEKFMEYQNKRGGRVKLQSILMPFS
EFDHEEKGDALYAMELALSLEKLTNEKLLKLQSVGVKNNDVQLVDFVESEFLGEQVEAIKKISEYVAQLRRIGKGHGVWH
FDQMLLDEQELLHAG*

DNA
ATGTTGCTTAAGGCTTCTCCCGCGCTTTCTATCTTGAACTCCGGTGTCGGAGATCTCTTTCCACCGTCGAATGTTCTGTT
TCCTTCCACCACGTGCCGTGGATCTAGGTTGTCTGTTCGGGCGGCGAAAGGAACGAGCACAAAGTCTTTAACCGGAGTTG
TGTTCGAGCCTTTTGAGGAAGTGAAGAAAGATATGGATCTGCTCGTTCCCACAACTCCTCTGACTTCTCTGGCCCGCCAC
AAGTTCTCGGACGAGTCCGAATCTGCTGTTAACGAACAGATCAATGTGGAGTACAATGTCTCATACATCTATCATGCCTT
GTATGCCTACTTTGACCGAGATAACGTTGGTTTGAAAGGTTTCGCCAATTTCTTCAAAGATTCGTCTACTGAAGAACGGG
GTCACGCTGAGAAGTTTATGGAGTACCAGAACAAGCGTGGTGGGAGAGTGAAGCTGCAGTCTATTCTGATGCCATTCTCT
GAGTTTGATCACGAGGAGAAAGGTGATGCATTGTATGCTATGGAGCTTGCACTATCTTTGGAGAAACTTACAAATGAAAA
GCTTCTCAAGTTGCAAAGTGTGGGTGTGAAAAACAACGATGTTCAGCTGGTTGATTTTGTCGAATCTGAGTTTCTAGGAG
AGCAGGTCGAAGCTATCAAGAAAATCTCAGAGTACGTTGCACAGCTAAGAAGGATTGGAAAGGGTCATGGGGTGTGGCAT
TTTGACCAAATGCTTCTGGATGAGCAAGAGCTTCTGCATGCGGGTTAA