Details for Chinese cabbage Locus Brara.E02959

Position : A05 ( 5`- 24925320 .. 24925838 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02959

Protein [Map View]
MRGHEPRSSSSCAACKLLKRRCTPTCIFAPHFRSSDQITFAKVHKVFGASNVSKLLSEVPEEQRQETVNSLAYEADVRLK
DPVYGCIGAIASLQKKMLELQHDIAVARNRLLAHNAAGGVNNNNSHVLLSPLVDDSSQLAAFLDLVPYSDLMLLDGSGLD
AYLFDIGQPPFV*

DNA
ATGAGAGGGCATGAGCCAAGATCAAGCTCCTCATGTGCAGCTTGCAAGCTCTTGAAGAGAAGATGCACGCCCACTTGCAT
CTTCGCTCCTCATTTCCGCTCAAGCGACCAGATAACTTTCGCCAAAGTCCATAAAGTCTTTGGAGCCAGCAACGTCAGTA
AGCTTCTCAGCGAGGTTCCTGAAGAGCAGAGACAAGAGACCGTTAACTCCTTGGCTTATGAAGCTGACGTTCGTCTCAAG
GATCCTGTCTACGGTTGTATTGGAGCTATAGCTTCTCTTCAGAAGAAGATGCTTGAGCTTCAACATGATATAGCCGTTGC
TCGCAATCGGCTACTTGCCCATAATGCTGCTGGTGGTGTCAACAACAACAACAGCCACGTGTTGTTGTCTCCTTTGGTTG
ATGATTCTTCTCAGCTTGCTGCTTTTCTTGATCTTGTGCCTTATAGTGACTTGATGCTGCTTGATGGGTCTGGTCTTGAT
GCTTACTTGTTTGATATTGGACAGCCTCCTTTTGTATAG