Details for Chinese cabbage Locus Brara.E02958

Position : A05 ( 5`- 24923213 .. 24924768 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02958

Protein [Map View]
MDTTPETQSKSGGSSRLPPGREDWWSEDATATLIEAWGDRYVHLSRGNLRQNDWKEVADAVNSRHGNNGRPKTDVQCKNR
IDTLKKKYKTEKAKPSPSSWCFFDKLDFLIGPVALKKSTAAGPAGVFKSPSTKAGLKLNQAGSISSGSSLDDDDDDDDDD
VEGDWGFVARKHRRVEDEDLCPDPGEGSSCRELARAILKLGEVYERIESAKQGMMIELEKQRMEAAKEIELQRMNMLMDM
QMELEKSKLGKRRAAASGKKL*

DNA
ATGGACACGACGCCGGAGACTCAATCGAAGAGCGGCGGCTCAAGCCGTCTCCCGCCGGGACGCGAAGACTGGTGGAGCGA
GGACGCGACGGCGACGCTGATCGAAGCCTGGGGAGACCGATACGTCCACCTCAGCCGCGGAAACCTCCGGCAGAACGACT
GGAAAGAAGTCGCCGACGCCGTCAATTCTCGCCACGGCAACAACGGCCGGCCGAAGACCGACGTGCAGTGCAAGAACCGG
ATCGACACGCTGAAGAAGAAGTACAAGACGGAGAAGGCGAAGCCTTCTCCGTCGTCTTGGTGCTTCTTCGACAAGCTAGA
CTTCCTCATCGGCCCCGTCGCGCTGAAGAAATCCACCGCCGCCGGTCCTGCCGGAGTTTTCAAATCGCCGTCGACGAAGG
CTGGTTTGAAATTGAATCAGGCCGGATCTATTTCGAGTGGAAGCTCTCTTGACGACGATGACGATGACGATGATGATGAC
GTGGAGGGTGATTGGGGGTTTGTGGCGAGGAAGCATCGGAGAGTGGAGGATGAAGATCTATGTCCAGATCCGGGTGAAGG
ATCGTCGTGTAGGGAGCTAGCGAGAGCGATTCTGAAGCTAGGAGAGGTGTACGAGAGGATCGAGAGCGCGAAGCAGGGGA
TGATGATTGAGTTGGAGAAGCAGAGGATGGAAGCTGCCAAGGAGATTGAGTTACAACGTATGAACATGTTGATGGATATG
CAGATGGAGCTTGAGAAGTCTAAGCTTGGCAAACGTAGAGCTGCTGCTTCAGGTAAGAAGTTGTAG