Details for Chinese cabbage Locus Brara.E02957

Position : A05 ( 5`- 24920026 .. 24920854 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02957

Protein [Map View]
MTSSSPSPRASMLLYWHENQYDDRNFKIHGRTVFFVVALFSVVLFFALLTLYIHRSCLVRDLTDFHAPSPPFTPYVSGGL
DPTEIRSLPVVLCRREAEEEERECCICLGGLEEGEKMKVLPLCRHCYHCECVDRWLMTESSCPLCRVSIRVDSSVSLPVH
GTETTTC*

DNA
ATGACGTCATCATCACCGTCTCCAAGAGCCTCTATGCTTCTGTACTGGCACGAGAACCAGTACGACGACCGGAACTTCAA
GATTCACGGTCGGACAGTTTTCTTCGTCGTGGCTTTATTCTCCGTCGTCCTCTTCTTCGCGTTACTCACTCTCTACATCC
ACCGGAGCTGCCTCGTTCGCGATCTCACCGACTTCCACGCGCCGTCTCCTCCGTTTACGCCGTACGTCAGCGGAGGTCTT
GACCCGACGGAGATTCGGAGTTTGCCGGTGGTGCTGTGCCGGAGAGAAGCGGAGGAGGAAGAGAGGGAGTGTTGTATATG
CCTCGGTGGTTTAGAAGAAGGAGAGAAGATGAAAGTGCTTCCGCTCTGTCGCCACTGTTACCACTGCGAATGTGTGGACC
GGTGGCTTATGACCGAGTCGAGTTGTCCGCTGTGCCGAGTCTCGATCAGAGTCGACTCGTCCGTGTCGTTGCCAGTGCAT
GGGACTGAAACGACAACGTGTTGA