Details for Chinese cabbage Locus Brara.E02956

Position : A05 ( 5`- 24910808 .. 24919705 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02956

Protein [Map View]
MAAANAPITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL
ALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVSFWKWITPKMLGLVTQTSVYHWSIEGDSEPVKMFDRTANLANNQII
NYKCSPNEKWLVLIGIAPGSPERPQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVLGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFSKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDLETASAIYRNRISPDPIFLTS
EASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES
PQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYMFLLQTILRTDPQGAVNFALMMSQMEGGCPVDY
NTITDLFLQRNLIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAILANGMFSHYDRPRVAQLCEKAGLYIQS
LKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDSCIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFGFVPD
LTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLV
SEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWDKVLLEENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQN
LLILTAIKADPSRVMDYINRLDNFDGPAVGDVAVDAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDS
VWSQVAKAQLRDGLVSDAIESFIRADDATHFLEVIRATEDANVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKIERLGEI
EEFILMPNVANLQQVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEF
RLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIP
KLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVL
ALRLDHTRVVDIMRKAGQLRLIKPYMVAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVE
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALEHA
WINNMLDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLALPAPPMPGMGGGPGMGGG
YGPPPQMGGMPGMPPMPPYGIPPMGGY*

DNA
ATGGCGGCAGCTAACGCCCCCATCACGATGAAGGAGGTCCTAACGCTTCCGAGCATTGGGATCAATCAGCAGTTCATCAC
GTTTACGAATGTTACTATGGAGTCTGACAAGTACATATGTGTACGAGAGACGGCGCCTCAGAACAGCGTTGTGATTATTG
ATATGAATATGCCGATGCAGCCTCTAAGGAGACCTATTACTGCTGATTCTGCTCTTATGAACCCGAACTCGAGGATTCTT
GCCTTGAAAGCTCAAGTGCCAGGAACTACTCAGGATCATCTGCAGATATTTAACATCGAAGCAAAAGCGAAGTTGAAATC
ACATCAGATGCCTGAGCAGGTTTCTTTTTGGAAATGGATTACACCAAAGATGTTGGGGCTGGTTACACAAACTTCCGTGT
ATCATTGGTCGATTGAAGGTGATTCTGAGCCTGTTAAGATGTTTGATAGAACGGCCAATTTGGCAAACAATCAAATTATT
AACTATAAGTGCTCTCCTAATGAGAAGTGGTTGGTGTTGATTGGAATTGCCCCTGGCTCTCCTGAGAGACCACAACTGGT
GAAAGGGAATATGCAGCTTTTCTCTGTTGATCAACAGCGGAGTCAGGCCCTTGAAGCACATGCTGCTTCATTTGCCCAGT
TTAAGGTCCTTGGGAATGAGAATCCTTCTATTCTTATATCCTTTGCGAGCAAGAGCTTTAACGCTGGACAGATAACATCA
AAATTGCATGTCATTGAGCTTGGCGCCCAACCAGGAAAACCATCATTTTCCAAGAAGCAGGCAGATCTCTTCTTCCCCCC
AGATTTTGCTGATGATTTTCCTGTAGCCATGCAGGTCTCTCACAAATTTAACTTGATATACGTCATCACCAAGCTTGGCC
TGTTGTTCGTATACGATTTAGAGACGGCTTCTGCCATCTACAGAAATCGGATAAGCCCAGACCCAATCTTCTTGACTTCT
GAAGCTTCTTCAGTTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTCCTGGCTACAGTAAATGAGGCTACGAT
AATACCTTTTATCAGCGGTCAATTGAACAATTTGGAACTTGCTGTCAATCTGGCTAAAAGAGGAAACCTCCCTGGTGCAG
AAAATCTGGTTGTCCAGCGGTTCCAAGAGTTATTTGCTCAAACTAAGTACAAGGAGGCTGCTGAGCTTGCTGCTGAATCT
CCTCAGGGGATTCTACGGACACCTGATACGGTGGCTAAATTCCAGAGTGTTCCAGTGCAAGCAGGGCAAACTCCTCCGTT
GTTACAGTATTTTGGGACCCTTTTGACTAGAGGGAAGCTCAATTCATATGAGTCATTGGAACTATCTCGTCTTGTTGTGA
ATCAAAACAAGAAGAACCTCTTGGAAAACTGGTTGGCAGAGGATAAATTAGAATGCAGTGAAGAGCTTGGAGACCTTGTC
AAGACTGTAGATAATGACCTTGCTCTGAAAATATACATCAAAGCTCGAGCTACTCCAAAAGTTGTAGCAGCTTTTGCAGA
GCGAAGGGAGTTTGACAAAATACTGATTTACTCAAAGCAGGTTGGGTACACACCTGATTACATGTTTCTTTTGCAAACCA
TACTCCGTACGGATCCCCAGGGAGCAGTAAATTTTGCTTTAATGATGTCCCAAATGGAAGGAGGCTGTCCAGTTGACTAC
AATACCATCACTGATCTTTTCCTTCAGAGAAACCTGATCCGTGAAGCGACTGCTTTCCTTCTGGATGTTCTGAAGCCAAA
TTTACCTGAGCATGCTTTTCTGCAAACTAAGGTTCTGGAGATCAATTTGGTAACCTTTCCCAATGTGGCTGATGCAATTT
TAGCAAATGGGATGTTTAGCCACTATGACCGGCCTCGTGTTGCTCAGCTTTGTGAAAAGGCTGGACTTTATATCCAATCT
TTAAAGCATTACTCGGAGTTACCTGATATTAAACGTGTAATTGTGAACACACATGCTATTGAGCCCCAGGCTCTTGTCGA
GTTTTTTGGCACTCTTTCTAGCGAGTGGGCTATGGAGTGCATGAAGGATCTTTTGCTGGTCAACCTGAGAGGCAACCTTC
AGATAATAGTTCAGGCTTGCAAGGAGTACTGCGAGCAACTTGGTGTTGATTCATGCATTAAACTCTTTGAGCAGTTCAAG
TCTTATGAAGGGCTATACTTTTTCCTAGGTTCATATTTGAGTATGAGTGAGGATCCTGAAATTCACTTCAAGTACATTGA
AGCAGCTGCCAAGACGGGTCAAATTAAGGAAGTTGAGCGTGTAACTAGAGAGTCTAACTTTTATGATGCTGAAAAGACGA
AGAACTTTTTGATGGAAGCTAAGCTTCCTGATGCCAGACCTTTGATAAATGTCTGCGACCGTTTTGGCTTTGTGCCTGAT
CTTACTCATTACCTGTACACAAACAACATGCTTCGTTACATCGAAGGTTACGTGCAGAAGGTGAACCCTGGGAATGCTCC
CCTGGTTGTGGGGCAGTTGCTTGATGACGAATGCCCAGAAGATTTCATAAAAGGCCTCATTCTTTCTGTTCGTTCATTGC
TTCCTGTTGAGCCCCTTGTCGACGAATGCGAGAAAAGAAATCGACTCCGTCTCCTCACTCAGTTCTTGGAGCATCTAGTT
AGTGAGGGAAGCCAAGATGTGCATGTCCATAATGCCTTGGGTAAAATTATCATAGACAGTAACAACAACCCTGAGCATTT
CCTGACCACCAACCCTTACTACGACTCTAAGGTTGTGGGTAAGTACTGTGAAAAACGTGATCCCACCCTGGCTGTTGTGG
CATACAGAAGAGGACAATGTGATGAGGAGCTCATCAATGTCACCAACAAGAACTCTTTGTTCAAGTTACAAGCCAGGTAT
GTAGTGGAGAGGATGGATGGTGACCTCTGGGATAAGGTTCTTCTGGAAGAAAATGAGTATAGAAGACAACTTATTGACCA
AGTTGTGTCTACTGCTTTACCTGAAAGCAAGAGCCCAGAGCAAGTTTCTGCAGCTGTTAAAGCATTCATGACTGCTGATC
TGCCACACGAGCTTATCGAGCTTCTTGAAAAGATTGTGCTTCAAAATTCTGCCTTCAGCGGAAACTTCAATCTGCAAAAT
CTGCTTATACTGACAGCTATCAAGGCAGATCCGTCTAGAGTTATGGATTACATTAACAGGCTGGATAACTTTGATGGTCC
GGCTGTTGGAGATGTGGCGGTTGATGCCCAATTATATGAAGAAGCGTTTGCAATTTTTAAGAAGTTTAACTTAAATGTTC
AGGCTGTCAACGTATTGCTGGACAACGTCAGAAGCATTGAGCGTGCTGTTGAGTTTGCTTTCCGGGTCGAAGAAGATTCT
GTTTGGAGCCAAGTCGCCAAAGCTCAACTCAGGGATGGGCTAGTCAGTGATGCAATTGAGTCTTTTATTCGAGCTGATGA
TGCCACTCATTTCTTGGAGGTCATACGTGCTACTGAAGATGCTAATGTCTATGATGACTTGGTCAAATACCTTCTTATGG
TTAGACAGAAGGTGAAGGAACCCAAGGTTGATAGTGAACTCATATATGCTTATGCAAAGATTGAAAGGTTGGGTGAGATA
GAGGAGTTTATTCTGATGCCGAACGTTGCTAACCTACAACAAGTGGGCGATCGCCTTTATGATGAAGCTTTGTATGAGGC
TGCAAAAATAATCTATGCGTTCATATCGAACTGGGGCAAGTTAGCCGTCACACTTGTGAAGTTGCAGCAGTTCCAAGGTG
CTGTTGATGCTGCAAGGAAAGCGAACAGTGCAAAGACTTGGAAGGAAGTCTGCTTTGCTTGTGTTGATGCAGAAGAATTC
CGATTGGCTCAAATATGTGGACTTAACATTATCATACAGGTGGATGACCTGGAAGAAGTCAGCGAGTACTACCAGAACAG
AGGATGCTTCAATGAATTAATCTCACTTATGGAGAGTGGACTTGGTCTGGAACGGGCTCACATGGGGATCTTCACCGAGT
TGGGTGTACTGTACGCCAGATATCGTTATGAGAAGCTTATGGAACACATCAAGCTGTTCTCGACTCGTCTCAATATTCCC
AAGCTTATCCGCGCCTGTGATGAGCAACAGCATTGGCAGGAACTTACCTATCTGTACATTCAATATGATGAGTTTGATAA
TGCTGCAACTACTGTCATGAACCATTCTCCTGAAGCGTGGGAGCACATGCAATTCAAAGACATTGTCGCCAAGGTTGCAA
ATGTCGAGCTTTACTACAAGGCCGTTCACTTCTACTTGCAAGAGCACCCTGATATAATCAACGATCTTCTCAATGTGCTT
GCTCTGCGGTTAGATCACACACGTGTGGTGGATATTATGCGCAAGGCTGGTCAGCTGCGCCTTATCAAGCCCTATATGGT
TGCAGTTCAGAGCAATAATGTTTCCGCTGTGAATGAAGCTCTGAATGAGATATACGTAGAAGAAGAAGACTATGATAGGT
TGCGTGAATCTATTGATTTGCATGACAGCTTTGACCAGATAGGCCTCGCTCAGAAGATTGAGAAACACGAGCTTGTTGAA
ATGAGACGTGTGGCTGCGTATATCTACAAGAAAGCTGGTAGATGGAAGCAATCAATTGCATTGTCGAAGAAAGATAACAT
GTACAAGGACTGTATGGAAACTGCTTCACAATCCGGCGACCATGACCTTGCAGAACAACTTCTGGTTTACTTCATTGAAC
AGGGGAAGAAGGAATGTTTTGCCACATGTCTCTTTGTCTGCTATGACTTAATCCGACCAGATGTTGCTCTGGAACATGCT
TGGATCAACAATATGCTCGACTTTGCCTTCCCGTATCTCCTCCAGTTTATCCGAGAGTACTCTGGCAAAGTGGACGAACT
AATCAAGGACAAGCTAGAGGCACAGAAAGAAGTGAAGGCCAAAGAGCAGGAAGAGAAGGATGTCATGTCCCAACAGAACA
TGTACGCCCAGTTATTGCCACTGGCTCTACCTGCCCCACCGATGCCAGGAATGGGAGGAGGTCCAGGGATGGGAGGCGGT
TACGGTCCGCCACCACAGATGGGAGGAATGCCTGGAATGCCTCCAATGCCACCATATGGAATCCCACCGATGGGCGGCTA
CTAA