Details for Chinese cabbage Locus Brara.E02954

Position : A05 ( 5`- 24892173 .. 24895310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02954

Protein [Map View]
MNNQDKIMIEKETTDKIEIKSKNGLNEQELEVKMDNMSDLNKTTNGLGEKWPEPIIRVQSLAESNLATVPDRFIKPPSQR
PNETITINNQPEAAAINIPVVDLRSILSGNQEETERISEACREFGFFQVINHGVRPELMAAAREAWRSFFHLPVEAKEAY
SNSPSTYEGYGSRLGVEKGALLDWNDYYFLNFLPLALKDLNKWPSLPSNIREVVDEYGEELVKLGESLMRILSSNLGVNE
EQLQEAFGGEDFSACMRVNYYPKCPRPELALGLSPHSDPGGITILLPDDQVAGLQVHHGDTWITVNALPNAFVVNLGDQM
QILSNSIYKSSEHRVIVNSQKERVSLAFFYNPKSDIPIQPLEQLISSTNPPLYPPMSYDQYRLFIRTHGPRGKSYVESHV
SLVNG*

DNA
ATGAATAACCAAGACAAAATCATGATCGAGAAGGAGACCACCGACAAGATCGAGATCAAGAGCAAGAACGGCCTCAACGA
ACAAGAACTGGAAGTCAAGATGGACAACATGAGCGACCTAAACAAAACCACGAATGGCCTCGGCGAGAAATGGCCAGAAC
CAATCATCCGAGTGCAGTCCCTGGCCGAGAGCAACCTCGCCACCGTCCCCGACCGTTTCATCAAGCCGCCGTCTCAACGC
CCTAATGAAACCATCACTATCAACAATCAACCGGAAGCTGCCGCGATAAATATCCCAGTCGTAGACCTAAGGAGCATCTT
ATCCGGCAACCAAGAGGAAACGGAGAGGATCTCGGAAGCATGCCGTGAGTTTGGCTTCTTTCAGGTGATCAACCATGGGG
TGAGGCCGGAGCTGATGGCCGCCGCTAGAGAAGCTTGGAGAAGCTTCTTCCATTTGCCTGTAGAAGCCAAAGAAGCTTAC
TCAAACTCCCCAAGTACCTACGAAGGTTACGGAAGCAGATTGGGTGTGGAAAAGGGAGCACTTCTTGATTGGAATGATTA
TTACTTTCTAAATTTTCTTCCTCTTGCCTTGAAGGATCTCAACAAATGGCCTTCTTTACCATCAAACATTAGAGAAGTGG
TGGACGAGTACGGTGAAGAACTAGTTAAGCTAGGCGAGAGCCTTATGAGGATATTATCGTCAAACTTGGGAGTAAATGAA
GAACAACTTCAAGAAGCATTTGGTGGAGAAGACTTTAGTGCATGTATGAGGGTTAACTATTACCCGAAATGCCCTCGACC
AGAGCTTGCCCTCGGCCTCTCCCCTCATTCAGATCCCGGCGGCATTACCATCCTCTTGCCGGACGATCAAGTCGCCGGCC
TTCAAGTCCATCACGGTGACACGTGGATTACCGTTAATGCTCTCCCCAACGCTTTTGTCGTCAATCTAGGCGATCAAATG
CAGATACTAAGCAATTCGATATACAAGAGTTCGGAGCATCGAGTGATAGTTAACTCGCAGAAAGAAAGGGTTTCACTTGC
ATTCTTCTATAACCCTAAGAGTGACATTCCTATCCAGCCACTGGAACAACTTATCAGCTCTACAAATCCTCCTTTATATC
CTCCCATGTCCTATGATCAATACAGACTCTTCATTCGAACTCACGGTCCACGTGGAAAATCCTACGTTGAGTCTCATGTA
TCCCTCGTTAACGGATAA