Details for Chinese cabbage Locus Brara.E02953

Position : A05 ( 5`- 24886550 .. 24888988 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02953

Protein [Map View]
MAAVSSNPRTVEEIFKDYTSRRSALLRALTKDVDGFYSQCDPEKENLCLYGHPNESWEVNLPAEEVPPELPEPALGINFA
RDGMQRKDWLSLVAVHSDCWLLSVSFYFGARLNRNERKRLFSLINDLPTLFDVVTGRKPIKDNKPSSDSGSKSRNGTKRS
IEGQPKSTTPKPMEGSYEDEDEDEEEDEHGDTLCGICGGNYTQDEFWICCDVCERWYHGKCVKITPAKADSIKQYKCPPC
CAKKGRQ*

DNA
ATGGCAGCCGTTTCCTCTAACCCTCGCACCGTCGAAGAGATCTTCAAAGATTACACCTCTCGTCGCTCCGCTCTTCTCCG
TGCTCTAACTAAAGATGTTGATGGTTTCTACTCTCAATGCGATCCGGAAAAGGAGAATCTTTGTTTGTACGGACACCCGA
ACGAGTCGTGGGAAGTGAATCTACCGGCGGAGGAAGTTCCTCCGGAGCTTCCTGAGCCAGCGCTTGGGATCAACTTCGCT
AGAGATGGTATGCAGAGGAAAGACTGGCTCTCTCTTGTTGCTGTCCATAGTGATTGTTGGCTTCTCTCTGTTTCTTTCTA
CTTTGGTGCTCGCCTTAATCGCAACGAGAGGAAGCGGTTATTCAGTTTGATCAACGATCTCCCAACTCTCTTCGATGTAG
TGACTGGTAGGAAACCCATCAAAGACAACAAACCAAGCTCGGATTCCGGAAGTAAATCCAGAAACGGCACTAAGAGATCA
ATAGAAGGGCAGCCAAAGAGCACAACACCAAAACCGATGGAAGGGAGCTACGAGGATGAAGATGAAGACGAAGAAGAAGA
CGAGCATGGAGACACTCTCTGTGGAATCTGTGGAGGCAATTACACACAAGATGAGTTCTGGATTTGCTGTGATGTTTGTG
AGCGTTGGTATCACGGAAAATGCGTGAAGATCACTCCTGCCAAAGCAGATAGCATCAAGCAGTATAAATGCCCTCCTTGC
TGTGCAAAGAAAGGAAGACAGTGA