Details for Chinese cabbage Locus Brara.E02952

Position : A05 ( 5`- 24883409 .. 24885858 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02952

Protein [Map View]
MVGPSRPQIVLFGSSIVQMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDQVFPKDAEVQPSLVVVYFGGND
SMAPHPSGLGPHVPLSEYVDNMKNIALHLQSLSDTTRIIFLSCPPVDEAKLRQNQSPYLSEVIRTNELCKTYSDACVELC
QELGLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSKLVAAEILRVIKEAEWTPSLHWKSMPTEFSEDSPYDLVSADGKN
TVNSSEWTYFWEEQWD*

DNA
ATGGTTGGACCGTCGCGGCCTCAGATCGTTCTGTTTGGATCATCCATCGTCCAGATGAGCTTCGGCCATGGAGGTTGGGG
GGCCATTCTCTCCGAGGTCTATGCTCGTAAGGCTGACATCATTTTGAGAGGATACTATGGATGGAACTCAACTCGTGCTT
TGGAAGTTGTGGACCAAGTCTTCCCCAAGGATGCTGAGGTACAACCTTCTCTGGTAGTTGTTTATTTCGGAGGAAACGAC
TCAATGGCGCCTCACCCTTCTGGTCTAGGACCTCACGTTCCTCTTTCTGAATACGTTGATAACATGAAGAACATCGCTCT
TCATCTTCAGAGCCTTTCAGACACAACTCGTATCATATTCCTTAGTTGCCCTCCAGTGGACGAGGCCAAACTTCGTCAGA
ACCAAAGCCCATACTTGAGCGAGGTGATCCGCACAAACGAGCTCTGCAAGACTTACTCAGACGCTTGTGTGGAGCTGTGC
CAAGAGCTAGGCTTACAAGTAGTTGATCTCTTCTCTACTCTTCAGAAAGCAGATGACTGGGAAACCGTTTGCTTCACAGA
TGGGATTCATTTGTCAGCGCAAGGAAGCAAGCTGGTGGCTGCAGAGATACTGAGAGTGATCAAAGAAGCGGAGTGGACAC
CGTCGCTTCACTGGAAATCGATGCCAACCGAGTTCTCTGAGGACTCACCTTACGATCTTGTTTCAGCTGATGGCAAAAAC
ACGGTCAACTCTTCAGAGTGGACTTACTTCTGGGAAGAACAGTGGGATTAA