Details for Chinese cabbage Locus Brara.E02951

Position : A05 ( 5`- 24880447 .. 24882903 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02951

Protein [Map View]
MAAPNVRTSSFSRNISVVSSSPQIPGLKCGPNGTTFISTGIRDLDRILGGGYPLGSLVMVMEDPEAPHHMDLLRTFMSQG
LVNNHPLLYASPSKDPRGFLGTLPNPGSSKEDKPTAPDLDQGESLRIAWQYRKYMENQKSSIDDYSNDFDMRKPLERQFL
AGRPIDCVSLLDSSDLSVAQDHCATFLSKFPRNSSNIASIGRIAIQSFCSPLCEYSDKESDMLSFIRLLKSMLMVSNAVA
IVTFPPSMLSPSSSTRLQHMADTLLSIKAIPDGDKELEKLLTGYKDINGFLNIHKVARINTQVPVILEAKTFSMSLKKRR
FLALECLNQAPVDGSSGTSYGTSGSCSGSSKSGALDF*

DNA
ATGGCTGCACCCAACGTTCGTACTAGCAGCTTCTCTCGCAACATATCAGTTGTCTCCTCATCCCCTCAAATACCTGGTCT
CAAATGCGGTCCTAATGGCACTACTTTCATATCCACTGGGATTCGTGATCTCGACAGGATACTAGGTGGTGGGTATCCTT
TGGGAAGTTTAGTGATGGTGATGGAAGATCCTGAAGCGCCGCATCATATGGATCTCCTGAGGACTTTTATGTCTCAGGGG
CTTGTTAACAACCATCCACTTCTTTACGCTAGTCCTTCCAAAGATCCTAGAGGGTTTCTTGGTACTTTGCCGAATCCTGG
ATCGTCCAAAGAAGATAAGCCTACTGCCCCAGACCTTGATCAGGGAGAGAGCTTGAGGATTGCTTGGCAGTATCGGAAGT
ATATGGAAAACCAGAAGAGTTCTATTGATGATTACTCCAATGACTTTGATATGAGAAAGCCATTGGAGAGGCAGTTTCTT
GCTGGACGGCCGATAGACTGTGTCAGTCTGCTAGATTCTTCCGATCTTTCTGTTGCTCAGGACCATTGCGCTACTTTTTT
ATCAAAATTTCCGAGAAACAGCAGTAACATTGCATCCATTGGCCGCATCGCAATCCAGTCATTCTGCTCTCCCCTTTGTG
AGTATTCTGATAAGGAATCAGACATGCTTTCCTTCATAAGATTGCTGAAAAGTATGCTGATGGTTTCAAATGCGGTAGCC
ATTGTTACTTTCCCGCCTTCCATGCTCTCCCCATCTTCGTCAACAAGACTGCAGCACATGGCGGATACCTTACTCTCTAT
CAAAGCGATCCCAGATGGTGACAAGGAATTGGAGAAGCTTCTCACTGGCTACAAGGACATAAATGGATTCCTCAACATAC
ACAAAGTTGCGCGTATCAATACACAGGTGCCTGTAATTCTAGAGGCAAAGACCTTCTCAATGAGCTTGAAGAAGAGAAGA
TTCTTGGCTCTAGAGTGTCTGAATCAAGCCCCTGTAGACGGATCCAGTGGAACATCGTATGGCACATCTGGGAGCTGCTC
TGGATCATCCAAATCCGGAGCACTCGATTTCTGA