Details for Chinese cabbage Locus Brara.E02948

Position : A05 ( 5`- 24872037 .. 24874490 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02948

Protein [Map View]
MSSKASSSRGGESIVADCGRNTSTCGYCKSPTSSSISHGLWTERLTVHDYQALLDRGWRRSGCYLYKPEMAKTCCPSYTI
RLRASDFVPSKEQQRVRRRLERFLDGELDLKPRERAEDQDVEVSEPVRKLLGSGKREQNNEVEPVMKDLSELIDNAVERC
IHSGEFPSNIQIPKSSVKKVLSAKRKKLAEGSEELLYTSNIAFPIVAAIKQTQTSQKGEGSNSAETVSEKLLSEMNKVGE
FPGLVIKVCKGHINFFSATQVTSSERDQGESLPSATTTTKSSSNSLQVRKKKLEIHLKRSSFDPEEYELYKRYQLRVHND
EPESISKTSYKRFLVDTPLIEVLPSSDGDDDDENVPPCGFGSYHQQYRVDGRLIAVGVIDILPKCLSSKYLFWDPDFASL
SLGNYSALQEIDWVKQNQAHCSALEYYYLGYYIHSCNKMRYKAAYRPSELLCPLRYQWVPFEVAKPLLDKKRYSVLSDFT
KASLSPAPQASETLVKSTREREDMEMNNSDEDSDSDSGVNGNDIANILISLNGARLRYKDLLRIINMAVRKQLEPMFISY
RKVVGAELSERMVYELQ*

DNA
ATGTCGTCGAAGGCGAGTAGCAGCCGTGGTGGAGAGAGTATCGTCGCTGATTGTGGGCGCAATACATCCACTTGCGGCTA
CTGTAAATCCCCTACGAGCTCCAGCATCTCTCACGGTTTGTGGACAGAGAGACTCACTGTTCATGATTATCAAGCTCTTC
TTGACCGTGGATGGAGACGATCTGGCTGTTACCTTTACAAACCTGAGATGGCTAAAACTTGTTGCCCTTCTTATACTATC
CGCTTGAGAGCTAGTGATTTTGTTCCATCTAAGGAGCAGCAGCGAGTGCGTAGAAGACTAGAAAGGTTCTTGGACGGTGA
GCTAGATCTGAAGCCGAGAGAGCGAGCGGAAGATCAAGATGTGGAAGTTTCAGAGCCGGTGAGAAAGTTACTTGGTTCTG
GTAAAAGAGAACAAAACAATGAAGTGGAACCAGTCATGAAAGATTTGTCTGAACTAATTGATAATGCGGTAGAAAGATGC
ATACACAGTGGGGAGTTTCCTTCTAATATTCAGATTCCAAAATCTTCGGTGAAGAAAGTTCTCTCTGCTAAAAGGAAGAA
GCTAGCTGAAGGGTCAGAAGAACTCTTGTACACCAGCAACATTGCTTTTCCAATTGTAGCTGCTATAAAACAAACACAAA
CATCTCAGAAAGGAGAAGGAAGCAACAGCGCAGAGACTGTTTCTGAGAAGTTGTTAAGTGAAATGAACAAGGTGGGAGAG
TTCCCTGGCTTGGTTATTAAGGTCTGCAAAGGCCATATCAACTTCTTTTCAGCTACACAAGTCACTTCCTCAGAGAGAGA
TCAAGGTGAAAGCCTCCCCTCCGCTACAACAACTACAAAGTCTTCTTCTAACAGCCTTCAGGTAAGAAAGAAGAAGCTGG
AGATACATTTGAAAAGGTCAAGTTTTGATCCAGAGGAGTATGAGTTATACAAACGTTATCAACTGAGAGTTCATAACGAT
GAGCCAGAAAGCATCTCAAAAACTTCGTACAAAAGGTTTTTGGTAGACACTCCGTTGATCGAAGTTCTCCCTTCAAGTGA
TGGTGATGATGATGATGAAAACGTTCCTCCTTGTGGCTTTGGTTCTTACCATCAACAATACAGAGTTGATGGACGTCTTA
TAGCTGTGGGAGTAATCGACATTCTTCCTAAATGTTTGTCTAGTAAATACCTATTCTGGGATCCGGATTTTGCATCCTTG
TCTCTTGGAAACTACTCTGCTCTCCAAGAGATCGATTGGGTGAAACAGAACCAAGCTCATTGCTCTGCTCTTGAGTATTA
CTATCTTGGTTACTATATACATTCTTGCAACAAGATGAGATATAAAGCAGCTTATCGTCCTTCCGAGCTTCTATGTCCTC
TCCGTTACCAATGGGTTCCATTTGAAGTAGCTAAGCCTCTACTTGACAAAAAGCGGTATTCTGTGTTGTCTGATTTCACT
AAAGCTTCTTTATCACCTGCACCTCAAGCTTCTGAAACACTAGTGAAGTCCACGAGGGAACGGGAAGACATGGAGATGAA
CAACTCTGATGAAGACTCAGATTCCGATTCTGGTGTTAACGGCAATGACATTGCCAATATCCTTATCAGTCTTAATGGAG
CTAGGCTTCGGTACAAGGATTTACTACGGATCATAAACATGGCAGTTCGTAAACAACTGGAACCGATGTTTATCAGTTAC
CGGAAAGTCGTGGGAGCTGAGCTCTCGGAGAGAATGGTGTATGAACTACAGTAA