Details for Chinese cabbage Locus Brara.E02947

Position : A05 ( 5`- 24867154 .. 24868172 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02947

Protein [Map View]
MSFPLKVRSVRGNTGGGGGTGTKCGRWNPTVEQLKVLTDLFRAGLRTPTTDQIQKISTELSFYGKIESKNVFYWFQNHKA
RERQKRRKISIDFDHHHQENDYISHHHHHHHRRQPSTRDVLEINEDEEERVIETLQLFPVNSFQESKVEKMRSRVNNQYR
EYIRETNTTTFPSYSSCGAEMEHPSPLELRLSFL*

DNA
ATGTCTTTCCCCCTGAAAGTTCGTAGCGTACGTGGCAACACCGGAGGAGGAGGAGGGACGGGGACGAAGTGCGGGAGGTG
GAACCCGACGGTGGAGCAGTTGAAAGTATTGACTGACTTGTTCAGAGCCGGTCTTAGAACTCCGACCACAGACCAAATTC
AGAAGATCTCTACAGAGCTCAGTTTCTACGGCAAGATCGAGAGTAAGAACGTTTTCTATTGGTTCCAAAACCATAAGGCT
AGAGAGAGGCAAAAACGCCGTAAAATCTCCATTGATTTTGATCATCATCATCAAGAAAATGACTATATCTCTCATCATCA
TCATCATCATCATCGTCGTCAACCATCAACTAGAGATGTTTTGGAAATAAACGAAGACGAGGAGGAGAGGGTAATAGAGA
CGCTACAACTCTTTCCGGTGAATTCATTCCAAGAATCCAAAGTGGAAAAAATGAGAAGCAGAGTCAATAACCAGTACCGT
GAATACATACGAGAGACCAACACGACCACGTTTCCTTCCTACTCATCATGTGGAGCTGAGATGGAACATCCATCGCCGTT
GGAACTTCGATTAAGCTTTCTTTGA