Details for Chinese cabbage Locus Brara.E02946

Position : A05 ( 5`- 24851919 .. 24853505 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02946

Protein [Map View]
METLNPLSHVPISDYRFVGQDMMSLQSPSSIWTKEENKMFERALAIYPEDSPDRWFKIASMIPGKTVFDVMNQYSKLEED
VFDIEEGRVPIPGYPSPLGLAQDTYRKRPNGARGSDHDRKKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQ
VASHAQKYYQRQLSGAKDKRRPSIHDITTGNLLNANLNSSFSDHRDILPDLGFIGKDNAEEGLMCMSPNLFSPSSAPFDA
AFNFAGVTAFSAGA*

DNA
ATGGAGACTCTGAATCCACTCTCTCACGTGCCTATCTCTGATTACCGGTTTGTTGGTCAAGATATGATGAGCTTACAAAG
CCCGAGCAGCATCTGGACTAAAGAAGAGAACAAGATGTTTGAACGAGCCCTTGCCATCTACCCTGAAGACTCCCCCGATC
GCTGGTTCAAGATTGCTTCCATGATCCCTGGAAAGACTGTTTTTGATGTTATGAATCAATACAGTAAGCTCGAAGAAGAC
GTTTTCGATATTGAAGAAGGACGCGTCCCCATTCCTGGTTACCCTTCTCCCTTAGGGTTAGCACAAGACACGTATCGAAA
GCGACCTAATGGAGCCAGAGGATCTGATCACGATAGAAAGAAAGGAGTCCCTTGGACAGAGGAAGAACACAGGAGATTTT
TGCTCGGGCTTCTCAAGTACGGGAAGGGAGATTGGAGAAACATATCGAGAAACTTCGTCGTGTCTAAGACCCCAACGCAA
GTGGCAAGCCATGCCCAAAAGTATTACCAGAGACAACTCTCTGGAGCAAAGGATAAGCGCCGGCCAAGCATCCATGACAT
CACAACCGGCAATCTTCTAAATGCCAATCTCAACAGTTCCTTTTCTGATCATAGAGATATCCTCCCGGATTTAGGGTTTA
TCGGAAAGGATAATGCCGAGGAGGGACTAATGTGTATGAGTCCGAATCTTTTCTCTCCATCATCAGCTCCCTTTGATGCT
GCCTTTAACTTTGCTGGAGTAACTGCATTTAGTGCCGGAGCGTAA