Details for Chinese cabbage Locus Brara.E02943

Position : A05 ( 5`- 24840421 .. 24843436 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02943

Protein [Map View]
MAADPNPNKFPVLSYVLSRLPSFTATKSSSPSSSSSVPAFDVEQPIEIVTQMPHLAHPSVLASMTKAISDVAQTRSILRT
LGPRPDHESVDKARAKLSEIEGVLSESLNDIAINEGKDEDEDEKKREEMGKDKTVCESILKLDEVHDSYERLLKEAEERL
VRMYESAAVAADEEGVAAVEVNEEVVGILQQALDNRVERVDLSGRKLRLLPEAFGRIQGLLVLDLSNNQLQAIPDSIAGL
HDLVELNVSGNILETLPDSIGLLSKLKILNVSTNKLTVLPDSICRCGSLVILDVSFNRLTYLPTNIGSELVNLEKLMIQY
NKIRSFPSSIGEMISLTYLDAHFNELHGLPDSFCLLANLEYLNLSSNFSDLIELPISFGDLINLQELDLSNNQIHALPDT
FGSLESLTKLNVSQNPLVVPPEEVVKEGAEVVKMYMGKRRISMFEEEEKRKMEEEMEQANAGWLTRTTSKLKTYVTDVSE
YLGSGSPRDSYLEQKL*

DNA
ATGGCGGCAGATCCCAACCCCAACAAGTTCCCCGTCCTCTCCTACGTCCTGTCTCGTCTCCCTTCCTTCACCGCCACCAA
ATCATCTTCCCCTTCCTCCTCCTCCTCCGTTCCCGCCTTCGATGTCGAGCAGCCGATCGAGATCGTCACCCAGATGCCTC
ACCTGGCGCACCCCTCCGTCCTCGCCTCCATGACCAAAGCCATCTCCGACGTGGCCCAGACCCGATCCATCCTCCGCACC
CTCGGGCCCAGGCCCGATCACGAGTCCGTCGACAAGGCGCGCGCCAAGCTCTCGGAGATCGAGGGGGTTCTATCCGAATC
GCTTAACGACATCGCGATCAACGAGGGGAAGGATGAGGATGAGGATGAGAAGAAGAGGGAAGAGATGGGGAAGGATAAGA
CTGTGTGCGAGTCGATTTTGAAATTGGACGAGGTTCATGATTCGTATGAGAGGCTGTTGAAGGAAGCGGAGGAGAGGCTT
GTGAGGATGTATGAATCCGCTGCGGTGGCGGCGGATGAGGAGGGAGTTGCGGCGGTTGAGGTTAATGAGGAGGTTGTGGG
GATACTGCAGCAGGCGTTGGATAATAGGGTGGAGCGTGTGGATTTGTCTGGGAGGAAGCTGAGGTTGCTACCTGAAGCGT
TTGGGAGGATCCAAGGGTTGCTTGTTCTTGATCTCTCCAACAATCAGCTCCAGGCTATTCCTGATTCAATAGCGGGACTG
CATGATCTTGTTGAGTTAAATGTATCCGGGAATATTCTGGAGACATTACCAGACTCTATCGGCCTCCTGTCCAAACTGAA
AATTCTGAATGTCTCGACTAACAAGCTCACCGTCTTGCCTGATTCCATCTGCCGTTGTGGGTCGTTGGTTATCTTGGACG
TGAGCTTCAACCGCCTCACCTACTTACCAACCAACATCGGGTCCGAGCTAGTGAATCTAGAGAAGCTAATGATCCAATAC
AACAAGATCCGATCCTTCCCGAGCAGTATAGGCGAAATGATATCCCTAACGTACCTCGACGCCCACTTCAACGAGCTCCA
CGGCCTTCCTGACTCTTTCTGTTTGCTCGCAAACCTCGAGTACTTAAACCTAAGCAGTAACTTCAGTGATCTCATTGAGC
TCCCTATTTCATTCGGGGACCTCATAAATCTCCAAGAGCTCGACTTGAGCAACAACCAAATCCACGCCCTCCCTGATACT
TTCGGCTCACTGGAAAGCCTGACGAAACTGAATGTGAGCCAGAACCCGCTCGTGGTCCCACCGGAGGAAGTGGTGAAGGA
AGGTGCAGAAGTGGTGAAGATGTATATGGGAAAGAGAAGGATAAGTATGTTTGAAGAAGAGGAGAAGAGGAAAATGGAGG
AGGAGATGGAGCAGGCAAACGCCGGGTGGCTCACGAGAACAACATCGAAGCTGAAAACGTATGTGACAGATGTTTCAGAG
TATCTGGGATCGGGTTCTCCTCGAGACTCTTACCTTGAGCAGAAGCTATGA