Details for Chinese cabbage Locus Brara.E02938

Position : A05 ( 5`- 24823111 .. 24824944 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02938

Protein [Map View]
MAGICCGVVGESEPTVTVDSSTRASLRRRLDLLPSIKIVAPPLESSRKRQKRETPSGNQDLESNVRSERNVEKKARSSPP
VKNSNLIPSSATEAESCFVSDAPKIGTTSVCGRRRDMEDAVSVHHSLIHKNSENLHFYGVFDGHGCSHVAEKCRERLHEI
VKRDVEAMAAGGEDEWKETMAKSFQKMDREVSQRDSNGAASRSVKSSCRCELQSPQCDAVGSTAVVSVVTPEKIVVSNCG
DSRAVLCRNGVAIPLSSDHKPDRPDELIRIQQAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDE
CLILASDGLWDVVTNETACGVARMCLQGAAAADGGDSDTAHNACSDASLLLTKLALARQSSDNVSVVVVDLRKRRSNNQV
S*

DNA
ATGGCTGGGATTTGCTGTGGTGTTGTTGGGGAGAGTGAACCAACGGTTACGGTTGATTCCTCTACTCGAGCTTCTCTGAG
ACGGAGGTTAGATCTACTCCCTTCGATCAAAATCGTCGCTCCTCCACTCGAGAGCTCCCGTAAGCGGCAGAAGCGTGAGA
CACCGTCGGGAAATCAAGATCTGGAATCGAATGTACGTAGTGAGAGGAACGTGGAGAAGAAGGCGCGATCATCACCACCG
GTTAAGAATTCAAATTTGATTCCGAGCTCCGCGACGGAAGCAGAGAGCTGTTTCGTCTCCGATGCGCCTAAGATCGGAAC
GACGTCGGTTTGCGGGAGGAGAAGAGACATGGAAGACGCCGTCTCGGTTCACCACTCGCTGATCCACAAAAACTCCGAGA
ATCTCCACTTCTACGGCGTTTTCGACGGCCACGGCTGCTCTCACGTCGCGGAGAAGTGCAGGGAGCGGTTGCATGAGATA
GTGAAGCGGGACGTCGAGGCTATGGCCGCCGGAGGAGAGGACGAGTGGAAGGAGACGATGGCGAAGAGCTTCCAGAAGAT
GGATAGAGAAGTTAGCCAGCGAGACTCTAACGGTGCGGCGAGTCGGAGCGTGAAGAGCTCGTGCAGATGCGAATTGCAGT
CTCCTCAGTGCGACGCCGTCGGATCCACCGCCGTCGTGTCCGTAGTCACGCCGGAGAAGATCGTCGTCTCTAACTGCGGA
GACTCTCGCGCCGTGCTTTGCCGTAACGGTGTTGCCATCCCTCTCTCTTCAGATCATAAGCCGGATCGACCCGATGAATT
GATTCGGATCCAACAAGCGGGCGGGCGGGTAATCTACTGGGACGGAGCTCGGGTTCTAGGAGTTCTCGCCATGTCGAGAG
CTATTGGTGATAACTATTTAAAACCGTATGTGATTCCGGATCCGGAGGTGACCGTGACGGATCGAACAGACGACGACGAG
TGCTTGATCTTAGCGAGTGATGGACTCTGGGACGTTGTGACGAACGAGACGGCGTGCGGCGTTGCTCGCATGTGCCTTCA
AGGTGCTGCTGCGGCCGATGGAGGAGACTCTGATACGGCGCACAACGCGTGTTCGGACGCTTCGTTGCTTCTGACGAAGC
TGGCTCTGGCGAGACAGAGCTCCGATAACGTTAGTGTCGTGGTGGTTGACTTGAGGAAAAGGAGGAGTAATAATCAAGTG
TCTTGA