Details for Chinese cabbage Locus Brara.E02934

Position : A05 ( 5`- 24799283 .. 24801712 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02934

Protein [Map View]
MSYTAESDDDGMHSPAGDSIGYGCKSRGKGSVLKKGPWTSTEDGILINYVRKHGEGNWNAVQKYTSLARCGKSCRLRWAN
HLRPNLKKGAFSQEEERLIVQMHAKMGNKWAQMAEHLPGRTDNEIKNYWNTRIKRRHRAGLPLYPPELHVEDLQWSEEYI
TSNVTRVNRRRHHQDILQLGNSKADVLFDDLNFATSLLPGASDVLDMFTCNMLGTGASSSPYESYMPPILPSPKQLRESG
SLFPICSSNIKQEFHSPEPFQNPRSCSISPCDVGHHSPYGNQRPSDVMISDSHAFTDGMLLTSKPLFGAVKLELPSFQYS
ETSGFDQWKTTPSPPHSDPLDSVDAYIQSPPPLEIEKDESNCFSSCDTGLLDMLLPNAKIKTSAKRSLALPEIPIPTQLS
AGENSPDSAGNVVKTEELDQVWEPKRVDITRPDVLLASSWLDQQGCFGIVRDSSNMSDALALLLGGEDIENTYVTVGSSS
SGQAQQGVESCTWTNMPPVWSL*

DNA
ATGAGTTACACGGCTGAGAGTGATGATGATGGTATGCACTCACCAGCTGGTGATAGTATTGGTTATGGATGCAAGAGCCG
AGGGAAAGGAAGTGTTCTGAAGAAAGGACCGTGGACTTCGACGGAAGACGGGATTTTGATTAATTATGTGAGGAAGCATG
GAGAGGGGAACTGGAACGCTGTGCAGAAATACACGAGCCTGGCTCGTTGTGGGAAAAGCTGTCGTCTCAGGTGGGCTAAT
CATCTTAGGCCGAACTTGAAGAAAGGAGCGTTTAGCCAAGAAGAGGAACGGCTCATTGTTCAGATGCATGCCAAGATGGG
GAATAAATGGGCACAGATGGCTGAACATTTGCCAGGCCGAACAGATAATGAGATAAAGAATTATTGGAACACTCGTATCA
AGAGGCGACACCGAGCAGGCTTACCACTTTACCCTCCTGAACTCCACGTTGAAGACCTGCAGTGGAGTGAGGAGTATATC
ACGAGCAATGTCACCAGGGTGAATAGAAGAAGACATCATCAAGATATCTTGCAGTTGGGGAATTCCAAAGCAGATGTCTT
GTTTGACGATCTTAATTTTGCTACCAGCTTGTTACCTGGAGCTTCTGACGTATTAGATATGTTCACATGCAACATGTTAG
GAACTGGTGCAAGTAGTTCCCCGTACGAAAGCTACATGCCACCAATACTGCCTTCCCCAAAGCAGCTCCGAGAATCTGGA
TCTCTGTTTCCCATCTGCAGCAGTAACATCAAGCAAGAGTTCCACTCTCCAGAACCTTTTCAGAATCCCAGATCTTGCAG
TATCTCGCCTTGTGATGTTGGTCATCATTCTCCTTACGGAAACCAACGTCCATCTGATGTGATGATTTCAGATAGCCATG
CCTTTACGGATGGCATGCTTCTTACTTCTAAGCCCTTGTTTGGGGCAGTGAAGCTGGAGCTCCCTTCATTCCAATATTCA
GAGACTAGTGGATTTGATCAGTGGAAGACGACACCGTCACCTCCACACTCAGATCCTCTTGACTCTGTTGATGCTTATAT
TCAATCTCCGCCACCGTTGGAGATAGAGAAAGACGAGTCAAACTGTTTCTCGTCATGCGACACTGGTCTACTAGATATGT
TACTTCCCAATGCCAAGATCAAAACTAGTGCAAAGCGTAGTTTGGCTCTCCCCGAGATTCCAATCCCCACGCAACTTAGT
GCGGGTGAAAATTCACCAGATTCTGCAGGGAACGTTGTGAAGACAGAAGAGTTGGATCAGGTTTGGGAACCAAAGAGAGT
TGATATAACACGGCCTGATGTTTTACTTGCATCGAGCTGGCTAGACCAACAAGGCTGTTTCGGGATTGTTAGAGACTCGA
GCAACATGAGTGATGCACTTGCGCTTCTTCTCGGTGGTGAAGACATTGAAAACACGTACGTTACCGTTGGGTCATCATCA
TCAGGTCAAGCACAACAAGGAGTTGAGTCTTGCACATGGACTAATATGCCTCCTGTTTGGTCCTTATAA