Details for Chinese cabbage Locus Brara.E02933

Position : A05 ( 5`- 24796221 .. 24799140 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02933

Protein [Map View]
MPSVRSDSSIKLLITYSEELVDGKPLYASSNSLPVKALNREPAGHAFHSAALKLHGCAEEPTDSEGDDKKAGGDDKEKEY
VPSFNSYSNKGKKKSGTQQQDHYALLGLSNLRYLATEDQIRKSYREAALKHHPDKMASLLLAEETEEAKEAKKEEIESRF
KAIQEAYEVLMDPLKRRIFDSTDEFDDEVPTDCAPQDFFKVFGPAFKRNARWSVNQRIPDLGDENTKLKEVDRFYNFWYA
FKSWREFPDEEEHDLEQADSREERRWMEKENARATAKARKEEHARIRTLVDNAYRKDPRIVKRKEEEKAEKQQKKDAKLM
AKKKQEEEAAIAAAEEKRRKEEEEKRAVESAQQQKKAKEKEKKLIRKERNRLRALSAPVVAQRLLDISEEDIESLCMTLN
IEELQSLCDKMGNKEGVELAKVIKDGSRDQEANSKEKESEKSNGGGGAERVSVLESTQKKQPWSKEEIDMLRKGMIKYPK
GTSRRWEVISEYIGTGRSVEEILKATKTVLLQKPDSAKAFDSFLEKRKPTATIASPLSTREELGESLPAGATTKVKPPVK
ETVVVGQSSESNGEASGSSVDTDGWSSVQERALVQALKTFPKETSQRWERVAAAVPGKTVIQCKKKFAELKEIIRSKKTA
V*

DNA
ATGCCGAGCGTTAGAAGCGACTCTTCCATTAAGCTACTAATCACATACTCCGAGGAGCTTGTTGATGGAAAACCCTTGTA
CGCTTCTTCCAACTCTCTTCCCGTGAAGGCTCTAAACCGCGAGCCTGCGGGTCACGCCTTCCACTCCGCGGCTCTCAAAC
TCCACGGCTGCGCAGAGGAGCCCACAGACAGCGAAGGCGATGACAAGAAAGCCGGAGGAGACGATAAAGAGAAGGAATAC
GTTCCTTCCTTCAACTCATATTCCAACAAAGGAAAGAAGAAGTCTGGTACACAACAGCAAGACCACTATGCGTTGTTGGG
GCTGAGCAACTTGAGGTACCTCGCAACAGAGGATCAGATCAGGAAAAGCTATCGTGAAGCTGCGCTGAAGCACCATCCTG
ATAAGATGGCTAGTCTCCTTCTTGCGGAGGAGACAGAAGAAGCCAAGGAGGCTAAAAAAGAGGAGATAGAGTCTCGCTTC
AAGGCGATCCAAGAGGCTTACGAGGTGCTGATGGATCCGTTAAAGAGGAGAATCTTCGACTCCACTGATGAGTTTGATGA
CGAGGTCCCCACGGACTGCGCACCGCAGGACTTTTTCAAGGTGTTCGGTCCAGCTTTCAAGAGGAACGCTAGGTGGTCTG
TGAACCAGCGTATACCTGATTTGGGAGACGAGAACACGAAGCTCAAGGAGGTTGATAGGTTCTACAACTTCTGGTACGCG
TTCAAGAGCTGGAGGGAGTTTCCTGATGAAGAGGAGCATGATCTTGAACAAGCCGACTCCCGCGAGGAGAGGAGGTGGAT
GGAGAAGGAGAACGCTAGAGCAACGGCCAAGGCTAGGAAGGAGGAGCATGCTAGGATCAGGACTCTTGTCGACAATGCGT
ATAGGAAGGATCCGAGGATTGTTAAGAGAAAGGAAGAGGAGAAGGCTGAGAAGCAGCAGAAGAAAGACGCGAAGCTTATG
GCTAAGAAGAAGCAGGAGGAGGAAGCTGCTATCGCCGCTGCGGAAGAGAAGAGGCGGAAAGAGGAAGAGGAGAAGCGAGC
GGTGGAGTCTGCGCAGCAGCAGAAGAAGGCTAAGGAGAAGGAGAAGAAGCTCATACGCAAAGAGCGTAACCGTCTTAGAG
CCCTCTCAGCTCCTGTGGTGGCTCAGCGTCTGCTTGACATCTCAGAGGAAGATATAGAGAGTCTTTGCATGACGCTTAAC
ATCGAGGAGTTGCAGAGTCTATGCGATAAGATGGGAAACAAAGAAGGGGTGGAGTTGGCTAAAGTGATAAAAGATGGTAG
TAGAGACCAAGAAGCCAACTCTAAAGAGAAAGAAAGTGAGAAAAGCAACGGCGGCGGCGGGGCAGAGAGAGTTTCTGTGT
TGGAGAGCACTCAGAAGAAACAGCCGTGGAGCAAGGAAGAGATTGACATGCTGAGAAAAGGAATGATCAAATATCCAAAG
GGGACGTCTCGGAGATGGGAAGTTATATCAGAGTACATCGGTACAGGAAGATCAGTTGAGGAGATTCTTAAAGCAACTAA
GACCGTTCTTCTCCAAAAACCAGATTCCGCCAAAGCGTTTGATTCCTTCCTCGAGAAGAGGAAACCGACCGCTACAATAG
CTTCCCCTCTCTCTACAAGAGAGGAGCTCGGAGAGTCTCTGCCGGCAGGAGCAACAACAAAGGTGAAACCACCTGTTAAA
GAGACTGTTGTTGTTGGTCAAAGCTCAGAGAGCAATGGTGAAGCAAGTGGAAGTTCAGTGGACACAGATGGTTGGTCTTC
TGTGCAAGAAAGAGCTTTGGTTCAGGCTTTGAAGACGTTCCCTAAAGAGACAAGCCAAAGATGGGAGAGAGTAGCTGCTG
CTGTTCCTGGGAAGACTGTGATTCAGTGCAAGAAGAAGTTTGCAGAGCTCAAGGAAATCATCAGAAGCAAGAAAACTGCA
GTCTAA