Details for Chinese cabbage Locus Brara.E02926

Position : A05 ( 5`- 24773372 .. 24774507 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02926

Protein [Map View]
MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGDDKTDIGMVVIRGNSIVTVEALEPVGRS*

DNA
ATGAGTCGATCAGGTCAACCTCCGGATCTCAAGAAGTACATGGACAAGAAGCTCCAAATTAAGCTGAATGCCAACAGAAT
GGTGGTTGGAACTCTCCGTGGGTTTGACCAGTTCATGAATCTTGTGGTGGATAACACTGTTGAAGTCAATGGTGATGACA
AAACTGACATTGGCATGGTGGTGATAAGAGGAAACAGCATTGTCACAGTTGAAGCGCTTGAACCAGTTGGAAGATCTTAG