Details for Chinese cabbage Locus Brara.E02924

Position : A05 ( 5`- 24763794 .. 24765406 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02924

Protein [Map View]
MPMTIEGKNSPLSALSYYLPDRIGIRFDIDFPFRSISPCLMRNIFWNARIDVFGTVLAGLAFMFSSSILLQILACAIYGN
WWPMLSALMYVVVPMPCMFFGGGSTQSLISRDGGGWIDAAKFLTGASTVGSLAIPIILRHAGMIETGAMLIEFTSFFIFI
CTVMCFHRASLDDDW*

DNA
ATGCCGATGACTATCGAAGGTAAAAATTCACCTCTCTCCGCTCTCTCTTATTATCTCCCTGACAGAATCGGGATCAGATT
CGATATTGATTTCCCCTTTCGTTCAATCTCTCCTTGCTTGATGCGGAATATCTTCTGGAATGCTCGAATTGATGTTTTTG
GTACAGTACTTGCTGGACTTGCCTTCATGTTTTCATCTAGTATCCTCCTTCAGATCCTGGCGTGTGCGATATATGGTAAC
TGGTGGCCAATGCTGTCAGCACTCATGTATGTGGTTGTGCCTATGCCATGTATGTTCTTTGGAGGAGGCTCAACCCAATC
CTTGATTAGTCGAGATGGTGGAGGGTGGATAGATGCAGCGAAGTTCTTGACAGGAGCATCAACCGTGGGAAGCCTGGCGA
TTCCAATCATTTTAAGGCATGCAGGAATGATTGAAACCGGTGCAATGCTGATAGAATTCACATCGTTTTTCATATTCATA
TGCACCGTCATGTGTTTTCACCGGGCTAGCCTGGATGATGATTGGTAA