Details for Chinese cabbage Locus Brara.E02922

Position : A05 ( 5`- 24755544 .. 24756516 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02922

Protein [Map View]
MKNESTFIDVPAESSSAMKGKSPLIGVAKDHTTGGYNRGLSIFDFLLRLAALVAASVAAGTMFTSDETLPFFTQFLQFEA
GYDDLPTFQFFVIAMSLVAGYIVLSLPISVVTIVRPLAAAPRLLLLVLDTAIMGLTMAAASSAAAISYVAHNGNQNTNWL
PICQQFGDFCQKTSGAVVSSFVAVVFFMILVVLSGVALKRH*

DNA
ATGAAGAACGAATCTACATTCATCGATGTTCCTGCAGAGTCCAGCTCAGCAATGAAAGGAAAATCTCCTCTAATCGGTGT
AGCTAAAGACCACACTACTGGTGGATACAATAGAGGTCTCTCAATCTTCGACTTCCTCCTCCGTTTAGCTGCCCTTGTTG
CAGCATCAGTGGCCGCTGGAACGATGTTTACCAGCGACGAGACTCTTCCTTTCTTTACACAGTTCTTACAGTTCGAAGCT
GGCTACGACGATCTACCAACTTTCCAGTTCTTTGTGATTGCCATGTCCTTGGTTGCAGGATACATCGTCCTCTCCCTTCC
TATCTCAGTAGTCACCATCGTTCGCCCTCTCGCCGCCGCTCCAAGACTCCTCTTGCTTGTTCTTGACACTGCGATTATGG
GGTTGACCATGGCGGCTGCATCATCGGCGGCAGCGATATCTTATGTAGCACACAATGGAAACCAGAACACGAACTGGCTT
CCCATTTGCCAACAGTTTGGTGACTTCTGTCAGAAAACCAGCGGAGCTGTCGTCTCCTCCTTTGTCGCTGTTGTATTCTT
CATGATCCTGGTCGTTCTCTCCGGCGTCGCTCTCAAGAGGCACTAA