Details for Chinese cabbage Locus Brara.E02919

Position : A05 ( 5`- 24741515 .. 24744261 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02919

Protein [Map View]
MSVNHYSNTLSSHNHHNEHKESLFEKSLTPSDVGKLNRLVIPKQHAERYLPLNNCGGGDDVTAESTEKGVLLSFEDESGK
SWKFRYSYWNSSQSYVLTKGWSRYVKDKHLNAGDVVLFQRHRFDIHRLFIGWRRRGEASSSSAVSQDPRANTTAYWNGLT
TPYRQVHASTSSYPNNIHQEYSHYGPVAETPTVAAGSSKTVRLFGVNLECHSDVVEPPPCPDAYNGQHIYYYSTPHPMNI
SFAGEAMEQVGDGRG*

DNA
ATGTCAGTCAACCATTACTCAAACACTCTCTCGTCGCACAATCACCACAACGAACATAAAGAGTCTTTGTTCGAGAAGTC
ACTCACGCCAAGCGATGTTGGAAAGCTAAACCGTTTAGTCATACCAAAACAACACGCCGAGAGATACCTCCCTCTCAATA
ATTGCGGCGGCGGCGACGACGTGACGGCGGAGTCTACGGAGAAAGGGGTGCTTCTCAGCTTCGAGGATGAGTCGGGCAAG
TCTTGGAAATTCAGATACTCATATTGGAACAGTAGTCAAAGCTACGTGTTGACCAAAGGATGGAGCAGGTACGTCAAAGA
CAAGCACCTCAACGCAGGGGACGTCGTTTTATTTCAACGGCACCGTTTTGATATTCATAGACTCTTCATTGGCTGGAGGA
GACGCGGAGAGGCTTCTTCCTCCTCCGCCGTGTCTCAAGATCCTCGAGCTAACACGACGGCGTACTGGAACGGTTTGACT
ACACCTTATCGTCAAGTACACGCGTCAACTAGTTCTTACCCTAACAACATCCACCAAGAGTATTCACATTATGGCCCTGT
TGCTGAGACACCGACGGTAGCTGCAGGGAGCTCGAAGACGGTGAGGCTATTTGGAGTTAACCTCGAATGTCACAGTGACG
TTGTGGAGCCACCACCGTGTCCTGACGCCTACAACGGCCAACACATTTACTATTACTCAACTCCACATCCCATGAATATC
TCATTTGCTGGAGAAGCAATGGAGCAGGTAGGAGATGGACGAGGTTGA