Details for Chinese cabbage Locus Brara.E02918

Position : A05 ( 5`- 24724278 .. 24727760 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02918

Protein [Map View]
MPRQNQTVENLLLLGKIRKRGCSSPTSSTSSVLREGYRFKRAIVVGKRGGSTTPVPTWRLMGRSPSPAASPGYAPSQCGS
KTGRGGAPAAPVSARKLAATLWEMNEMPSSPRGVEEVRKVRKERIAPLPPPPPRSRSVRSGSLPPHLSDPSHSPVSERME
RSGTGSRQRRASSTVQKLRLGDHNVVARDRISNASFMDIETRSRGETPTGSTTVGVKTRLKDCSNALTTSKELLKIINRM
WGQEDRPSSSMSLVSALHSELERARLQVNEVIREHRPENNDVTYLMKRFAEEKAAWKSHEQEVVEAAIESVAGELEVERK
LRRRFEGLNKKLGKELSDTKAALMKAVKEIENEKRARVMVEKVCDELARDISEDKAEVEELKRESFKVKEEVEKEREMLQ
LADALREERVQMKLSEAKHQLEEKNAAVDKLRNQLQTYLKAKRCKEKTLEPPQTEEYLNHHIGFGSYNIEDGEVEDENEE
DSGGESDLHSIELNMENKSYKWPYGEDNNRVGRKSTPSKSLSLQRSISDCVDWVVQSEKLQKSGDGGLDWGRSVEVEPKG
YLDETQAYKPSKASSKDHLLSGPRLSNFRGGSVSKSRLSDAAKSENQNARKSRW*

DNA
ATGCCGAGGCAGAACCAAACGGTGGAGAATCTGCTCCTCCTCGGGAAAATCAGGAAGCGCGGATGCTCCTCTCCGACGTC
GTCGACTTCCTCCGTTCTCAGGGAAGGCTACCGTTTCAAGAGAGCGATTGTGGTTGGGAAAAGAGGAGGATCCACCACTC
CTGTCCCCACGTGGAGGCTCATGGGCCGATCTCCTTCTCCGGCTGCTTCTCCGGGGTACGCGCCGTCGCAGTGCGGGAGC
AAGACCGGGAGAGGAGGAGCACCTGCGGCTCCGGTGTCGGCGAGGAAGCTGGCTGCGACTCTGTGGGAGATGAACGAGAT
GCCTTCTTCGCCGAGAGGTGTGGAAGAGGTTAGAAAGGTTAGGAAGGAGAGAATCGCGCCGCTTCCTCCTCCTCCGCCGA
GGTCGAGGTCGGTTCGTTCTGGTTCTCTGCCGCCTCACCTCTCTGATCCTTCGCATAGTCCTGTCTCTGAGAGGATGGAA
AGATCAGGGACTGGAAGCCGACAGAGAAGAGCATCCTCCACTGTGCAGAAGCTTAGGCTTGGAGATCATAATGTGGTGGC
TAGGGATCGTATTAGCAACGCTAGCTTCATGGATATTGAGACAAGATCACGGGGGGAGACACCGACTGGGTCAACAACCG
TGGGAGTCAAAACACGGTTGAAGGACTGTAGTAACGCTCTCACAACATCAAAAGAGCTTCTCAAAATCATCAACAGAATG
TGGGGTCAAGAAGACCGCCCATCTTCCAGCATGTCCCTCGTCTCAGCTCTCCACTCCGAGCTCGAAAGAGCTCGCCTACA
GGTCAACGAGGTCATCCGCGAACACAGACCTGAAAACAACGACGTCACCTACCTGATGAAGCGTTTTGCGGAAGAGAAAG
CAGCGTGGAAAAGCCACGAGCAAGAAGTCGTCGAGGCCGCGATAGAATCCGTCGCCGGCGAGCTCGAGGTGGAGAGGAAG
CTGAGGAGAAGGTTCGAGGGGTTGAACAAGAAGCTAGGCAAAGAACTATCCGACACAAAAGCAGCTCTGATGAAAGCGGT
GAAGGAGATAGAGAACGAGAAGCGAGCGAGAGTGATGGTTGAGAAAGTCTGCGACGAGCTTGCGAGAGACATCAGCGAAG
ACAAAGCCGAGGTCGAGGAGCTGAAGAGAGAGTCTTTCAAAGTGAAAGAAGAAGTCGAGAAGGAAAGAGAGATGCTGCAG
TTAGCTGACGCGTTGCGGGAGGAGAGAGTGCAGATGAAACTCTCGGAGGCTAAGCACCAGCTCGAGGAGAAGAACGCAGC
TGTTGATAAGCTGAGGAACCAGCTCCAAACCTACCTCAAAGCAAAGAGATGCAAAGAGAAGACCCTCGAACCGCCTCAGA
CTGAAGAGTACCTCAACCACCATATTGGTTTCGGTTCGTATAACATAGAAGATGGAGAAGTTGAGGACGAAAACGAAGAA
GATTCTGGGGGAGAAAGCGATCTTCACTCCATAGAACTGAACATGGAGAACAAGAGCTACAAATGGCCTTATGGAGAAGA
TAACAACAGAGTAGGGAGAAAGTCAACGCCGAGTAAAAGCCTTTCTTTACAAAGAAGCATATCGGATTGTGTTGATTGGG
TTGTACAGAGCGAGAAGCTTCAAAAGAGCGGAGACGGAGGATTGGACTGGGGAAGATCTGTTGAGGTTGAGCCTAAAGGT
TACTTGGATGAAACGCAAGCTTATAAACCAAGCAAGGCTTCTTCAAAAGATCATCTCCTCTCGGGTCCAAGACTAAGTAA
CTTCCGTGGTGGATCAGTTTCGAAGTCGCGGTTATCTGATGCAGCCAAAAGTGAAAACCAGAATGCTAGAAAATCGAGAT
GGTAA