Details for Chinese cabbage Locus Brara.E02915

Position : A05 ( 5`- 24715480 .. 24716981 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02915

Protein [Map View]
MASSVASSTTLISSTRVSPAKSSLPSPSSLSFLRTISSPLRSRFALRSSLSSCSRRSFAVKAQADDLPLVGNKAPDFEAE
AVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYAEFEKLNTEVLGVSVDSVFSHLAWVQTDRQSGGLG
DLNYPLVSDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGW
QPGEKSMKPDPKLSKEYFSAI*

DNA
ATGGCGTCGTCTGTAGCTTCTTCAACCACTCTCATCTCCTCCACTCGAGTTTCTCCAGCCAAGTCTTCGCTTCCATCTCC
CTCCTCCCTCTCTTTCCTTCGTACCATATCCTCTCCTCTCCGCTCTCGTTTTGCTCTCCGCTCTTCCCTCAGCTCCTGCT
CTCGCCGGAGCTTCGCTGTCAAGGCCCAGGCCGATGATCTTCCATTGGTTGGAAACAAGGCGCCTGATTTTGAGGCTGAG
GCTGTCTTTGATCAGGAGTTCATCAAGGTTAAGCTCTCTGAGTACATTGGGAAGAAGTATGTGATTCTCTTTTTCTACCC
TTTGGACTTCACTTTTGTCTGCCCAACAGAGATTACTGCCTTTAGTGATCGGTACGCAGAGTTTGAAAAGTTAAACACAG
AAGTGTTAGGTGTCTCTGTTGATAGTGTGTTTTCCCACCTTGCGTGGGTTCAGACAGACAGACAATCCGGAGGCCTTGGT
GATCTGAACTACCCCCTTGTTTCAGATGTAACTAAATCTATCTCAAAGTCTTTCGGAGTGCTCATCCATGATCAGGGAAT
AGCACTGAGAGGGCTTTTCATTATCGACAAGGAAGGAGTGATCCAGCACTCCACCATCAACAATCTTGGTATTGGCCGAA
GCGTCGATGAGACTATGAGAACCCTCCAGGCCTTACAGTACATTCAGGAGAACCCTGATGAAGTCTGCCCTGCAGGATGG
CAACCGGGTGAGAAGTCAATGAAACCTGACCCCAAGCTCAGCAAAGAGTACTTCTCTGCTATTTAG