Details for Chinese cabbage Locus Brara.E02912

Position : A05 ( 5`- 24694646 .. 24698337 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02912

Protein [Map View]
MAKEIQSQSPPSSTANGITYSSSSSSPSLSMMLSSTNAFSLLSKGWREVRDSADADLQLMRKRANSVKNLASTFDREIEN
FLNNSAMSAFPVVSSSSSSSAFGNEIGIMKKLEPKISEFRRVYSAPEISRKVMERWGPAKAKLGMDLSAIKKAIVSEMDL
DERELEMRRRRDRDRFREFYTEGEGEGSFGDWKPIRSLKSRFKEFEKRSSLELLIGFKNSELVEKLKASFQSLYKETDEA
KDVPPLDVPELLASLVRQSEPFLDQIGVRKDLCDRVVENLYKCKSQHLWRLPSSQASDLVENDNHVDDLDMRIASVLQST
GHHYDGGFWTDFLKPETQESKRHVAIVTTASLPWMTGTAVNPLFRAAYLAKSAKQSVTLVVPWLCESDQELVYPNNLTFS
SPEEQESYIRTWLEERIGFKADFKISFYPGKFSKERRSIFPAGDTSQFIPSKDADIAILEEPEHLNWYHHGKRWTDKFNH
VVGIVHTNYLEYIKREKHGAIQAFFVNHVNNWVTRAYCDKVLRLSGATQDLPKSVICNVHGVNPKFLMIGEKIAEERSRG
EQAFSKGAYFLGKMVWAKGYRELIDLMAKHKSDLGGFNLDVYGNGEDAVEVQRAAQKLDLNLNFLKGRDHADDALHKYKV
FINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTSEDFVNKVKEAMSKEPLPLTPEQMYNLSWEAATQ
RFMEYSDLDKILNDEDGGKRMRKSRSVPSFNEVIDGGLAFTHYVLTGNDFLRLCSGATPQTKDYDKQHCKDLKLVPPQAH
KPVYGW*

DNA
ATGGCGAAAGAGATTCAATCTCAATCTCCTCCGTCGTCTACGGCCAACGGAATCACGTATTCTTCTTCTTCCTCCTCGCC
GTCTCTGTCGATGATGTTATCCTCCACCAACGCGTTCTCGCTACTCTCGAAAGGGTGGAGGGAGGTGAGGGACTCCGCAG
ACGCGGATTTGCAGCTGATGCGGAAACGAGCGAACTCCGTTAAGAATCTAGCGTCGACGTTCGACCGCGAGATCGAGAAT
TTCCTGAATAACTCGGCGATGTCTGCGTTTCCCGTCGTGTCGTCTTCGTCGTCGTCGTCGGCGTTTGGCAATGAGATTGG
GATCATGAAGAAGCTTGAGCCGAAGATATCGGAGTTCCGCAGGGTTTACTCGGCGCCGGAGATTAGCCGGAAGGTGATGG
AGAGGTGGGGGCCGGCGAAGGCGAAGCTGGGGATGGATTTGTCGGCGATTAAGAAGGCGATTGTGTCTGAGATGGATCTG
GATGAGCGTGAATTGGAGATGAGGAGACGGCGGGATAGGGATAGGTTTAGGGAGTTTTACACTGAGGGAGAGGGAGAAGG
TAGTTTTGGAGATTGGAAGCCGATTAGGTCTTTGAAGAGTAGGTTTAAAGAGTTTGAGAAACGGAGCTCGTTAGAGTTAT
TGATTGGATTCAAGAACAGTGAGCTTGTGGAGAAGCTCAAAGCCAGCTTTCAATCACTTTACAAAGAAACTGATGAGGCC
AAGGATGTGCCACCATTGGATGTACCTGAACTTTTGGCTTCCTTGGTTAGGCAGTCTGAACCTTTTCTTGATCAGATTGG
TGTAAGAAAGGATTTGTGCGACCGAGTAGTAGAAAACCTTTATAAATGCAAGAGCCAACACCTTTGGCGCCTGCCATCTT
CACAAGCATCTGATTTAGTTGAAAATGATAACCATGTTGATGATTTGGATATGAGGATAGCCAGTGTTCTTCAGAGCACA
GGACACCATTACGATGGTGGCTTTTGGACTGATTTCTTGAAGCCTGAGACGCAAGAAAGCAAAAGGCACGTGGCAATAGT
TACAACAGCTAGTCTCCCGTGGATGACCGGAACAGCTGTAAATCCCCTTTTCCGAGCTGCTTATTTGGCAAAATCTGCAA
AACAGAGTGTTACACTCGTGGTTCCTTGGCTCTGCGAATCTGATCAAGAACTAGTTTATCCAAACAATCTCACCTTCAGT
TCACCTGAAGAACAAGAGAGTTATATACGTACATGGTTGGAGGAAAGGATTGGTTTCAAGGCTGATTTTAAAATCTCGTT
TTACCCGGGAAAGTTTTCGAAAGAAAGGCGCAGCATATTTCCTGCTGGTGACACTTCTCAATTCATACCGTCAAAAGATG
CTGACATTGCTATTCTTGAAGAGCCTGAACATCTCAACTGGTATCACCACGGCAAGCGGTGGACTGATAAATTCAACCAT
GTTGTTGGAATTGTCCACACAAACTACTTAGAGTACATCAAAAGGGAGAAGCACGGTGCTATTCAAGCATTTTTTGTCAA
CCATGTAAACAATTGGGTCACACGAGCATATTGCGACAAGGTTCTTCGTCTCTCTGGAGCAACGCAAGATTTGCCAAAAT
CAGTTATATGCAATGTCCATGGTGTCAATCCCAAGTTCCTTATGATTGGGGAGAAAATTGCTGAAGAGAGGTCCCGTGGG
GAACAAGCTTTCTCAAAAGGCGCATACTTCTTAGGAAAAATGGTGTGGGCTAAAGGATACAGAGAACTAATAGATCTGAT
GGCTAAACACAAAAGCGACCTCGGGGGCTTCAATTTAGATGTGTACGGAAACGGTGAGGATGCAGTCGAGGTCCAACGTG
CAGCACAGAAACTCGATTTGAATCTCAATTTCCTCAAAGGAAGGGACCATGCTGACGATGCTCTTCACAAGTACAAAGTG
TTCATAAACCCGAGCATCAGCGATGTTCTATGCACAGCAACCGCAGAAGCTCTGGCCATGGGGAAGTTCGTGGTGTGCGC
AGACCATCCTTCAAACGAGTTCTTCAGATCATTCCCAAACTGTCTAACCTACAAAACATCCGAAGACTTTGTGAACAAAG
TGAAAGAAGCAATGTCCAAAGAGCCGTTACCACTCACTCCTGAGCAGATGTACAATCTTTCTTGGGAAGCAGCGACACAG
AGATTCATGGAGTATTCGGATCTCGATAAGATCTTAAACGATGAAGATGGAGGAAAAAGGATGAGAAAATCAAGATCGGT
TCCGAGCTTTAACGAGGTGATCGATGGAGGACTGGCATTCACACACTATGTTCTCACAGGGAATGATTTTCTGAGACTAT
GCAGTGGAGCTACACCACAAACGAAAGACTATGATAAGCAACATTGCAAGGATCTGAAACTTGTTCCACCTCAAGCTCAC
AAGCCAGTCTATGGCTGGTAG