Details for Chinese cabbage Locus Brara.E02911

Position : A05 ( 5`- 24690021 .. 24692043 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02911

Protein [Map View]
MDLNAQVKKACFLQRLKDFPSKLKDGVTKRIKHVQKFGKDDPRRIIHSIKVGLSLTLVSMLYYVRPLYNSFGVSGMWAIL
TVVVVSEFTVGGTLSKGLNRAFATLIAGALGVGAVHLARLCGHKGEPIVLGILVFSLGAAATFSRFFPRIKQRYDYGALI
FILTFSMVAVSGYRTDEILVIAYQRLSTILIGGTICILVSIFVFPVWAGEDLHKMVANNIIKLANSLEGFEGEYFPSSEK
TSKGTNSSVREYKSILTSKSTEDTLANLARWEPGHGRFRLRHPWTKYLKIAGLVRQCAIHFEVLNGCVLSDAKAPQDFIS
KIQEPCSIISREAGEALKAIAKSIKTMSRYHVCVNTHIKNSKNAIENLRLALKVSFPETDKDLLEIIPVVTMASTLIDIV
SYVEKISESVDEFSVLAHFKENLDPKLSPELGQHHLLHKGTVKPVLEGDNEEECNNSPHVVIAVHDEQPPTVNENNVNLG
AEKTTVVVV*

DNA
ATGGATTTGAATGCTCAAGTGAAGAAGGCATGTTTCTTGCAAAGGCTTAAGGATTTCCCTAGCAAGCTCAAAGACGGTGT
CACCAAGCGCATAAAGCATGTGCAAAAGTTTGGGAAAGATGACCCAAGAAGGATCATCCATTCCATAAAAGTGGGACTTT
CTCTCACATTAGTTTCAATGTTGTACTATGTAAGGCCACTCTATAATAGCTTTGGGGTTTCCGGTATGTGGGCAATACTA
ACCGTAGTCGTGGTCTCCGAGTTCACTGTTGGTGGGACACTTTCAAAAGGGTTAAACAGAGCTTTCGCAACATTAATAGC
CGGTGCCTTAGGGGTTGGTGCAGTACACCTTGCTCGATTGTGTGGACACAAAGGAGAGCCTATTGTTCTTGGGATATTAG
TGTTCTCACTAGGTGCAGCTGCAACATTTTCGCGGTTTTTTCCAAGGATTAAACAGAGATATGACTATGGTGCCTTGATA
TTCATACTTACATTTAGCATGGTTGCTGTTTCGGGGTACCGTACAGATGAAATATTGGTTATTGCATATCAAAGACTATC
GACTATTCTCATTGGTGGAACAATATGCATTCTTGTGTCGATCTTCGTTTTTCCGGTATGGGCAGGCGAAGATCTTCACA
AGATGGTTGCTAACAACATTATCAAACTCGCTAACTCCTTAGAAGGTTTCGAGGGTGAATATTTTCCATCATCGGAGAAG
ACTTCAAAGGGGACAAACTCGAGCGTTCGAGAATACAAAAGCATTCTAACATCAAAAAGCACTGAAGATACTTTGGCGAA
TCTTGCGAGATGGGAACCAGGACATGGCCGATTCAGGTTACGCCATCCATGGACAAAGTACTTAAAGATCGCAGGACTCG
TTCGCCAATGCGCCATTCATTTCGAAGTTCTCAATGGCTGTGTTCTCTCTGACGCTAAGGCACCGCAAGACTTCATAAGC
AAGATTCAAGAGCCATGCTCGATTATTAGCAGAGAAGCTGGCGAAGCCCTAAAAGCCATAGCCAAATCTATCAAAACAAT
GAGCAGATACCATGTTTGTGTGAATACACACATTAAAAACTCCAAAAATGCCATAGAAAACCTAAGGCTTGCACTCAAAG
TTTCTTTCCCGGAGACAGATAAAGATCTCCTGGAGATCATTCCAGTAGTCACAATGGCGTCAACATTGATCGACATCGTG
AGTTATGTCGAGAAGATCTCTGAGTCTGTGGACGAATTTTCAGTTCTGGCACACTTTAAAGAGAATCTGGATCCAAAATT
ATCACCGGAGTTAGGACAACATCACCTACTTCACAAGGGAACTGTAAAGCCTGTTCTAGAGGGTGACAACGAGGAAGAAT
GCAATAACTCTCCTCATGTTGTTATCGCAGTCCATGATGAACAGCCACCAACAGTCAACGAAAATAATGTTAATTTGGGA
GCAGAGAAGACGACAGTTGTTGTCGTGTAA