Details for Chinese cabbage Locus Brara.E02902

Position : A05 ( 5`- 24652682 .. 24654232 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02902

Protein [Map View]
MARFLLLLCFLFAAALTSSLTSAGDDNHVYSPCSDSTVAVGDGFTFGIAFAAKDSFLGTNRSVQYSPCDRRHLSLNGNSE
LAVFRPKVDEITLLTINTSSSSSSYRPDSSKGYMVAFAGAKYAARSVPIMVADNDHVVTSFTLVLEFQKGRLENLFWKKD
GCSKCTGDAKFVCLNKEECAIKRQSCTNQGGQVDCSLGIQLAFSGTDKHYTALNSWYEVANLKQYSLYGLYSNLKDSLSS
QFSNIF*

DNA
ATGGCTAGATTCCTCCTCCTCCTCTGTTTCCTCTTCGCGGCGGCGCTGACGTCATCCCTGACATCCGCCGGCGACGACAA
TCATGTCTACTCGCCTTGCTCAGATTCCACCGTCGCGGTCGGCGACGGATTCACTTTCGGAATTGCCTTCGCGGCGAAAG
ACTCTTTCCTTGGCACCAACCGTTCCGTTCAGTACTCTCCCTGCGATCGTCGCCACCTCTCTCTCAACGGCAACTCTGAG
CTCGCCGTGTTCAGACCTAAAGTCGATGAGATCACGCTCCTCACCATCAATACCTCTTCAAGTTCCTCCAGTTACCGCCC
GGATTCCTCAAAGGGATATATGGTAGCATTCGCTGGTGCAAAATACGCTGCGAGATCAGTTCCAATTATGGTTGCAGACA
ACGATCACGTCGTCACAAGCTTCACCCTTGTTCTTGAGTTCCAAAAGGGCAGGCTTGAGAACTTGTTCTGGAAGAAAGAC
GGATGCTCCAAATGCACTGGAGACGCGAAGTTCGTGTGCCTCAACAAAGAAGAATGCGCAATCAAAAGACAAAGCTGCAC
GAACCAAGGAGGACAAGTAGATTGTAGCTTGGGGATCCAGTTGGCGTTTTCAGGCACGGATAAGCATTACACCGCGTTGA
ACTCTTGGTACGAGGTTGCTAATCTGAAGCAGTACTCGCTTTATGGCCTCTACTCTAATCTTAAGGATTCACTAAGCAGC
CAGTTCAGTAACATCTTCTGA