Details for Chinese cabbage Locus Brara.E02900

Position : A05 ( 5`- 24643323 .. 24645031 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02900

Protein [Map View]
MNDLFSSSFTRFRSSGEPSPQGTGVQMAHPAGVNLDKFFEDVESVKEELKELDRVNDTLQSSHEESKTLPNAQAVKDLRS
KMDGDVGVALKKAKMIKVKLEALDRSNAANRSLPGCGPGSSSDRTRTSLLNGLRKKLKDSMDSFNRLRELISSEYRETVQ
RRYFTVTGENPDEKTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLRELHQVFLDMAVLVEHQG
AQLDDIESHVGRASSFIRGGTEELHTARVYQKNTRKWTCYAIIILIIIIVVVVLAVVKPWQTNGSGSGGGGGGGGGGSPP
AQGQVPPPSPPQARRLLLR*

DNA
ATGAATGATCTATTCTCAAGCTCGTTCACTCGCTTCCGCAGCAGCGGAGAACCATCTCCTCAAGGCACCGGCGTTCAGAT
GGCGCACCCGGCGGGAGTGAACCTCGACAAGTTCTTCGAAGACGTTGAGTCAGTGAAGGAAGAGTTGAAGGAGCTGGATC
GTGTCAACGACACACTCCAATCCTCTCACGAGGAGAGCAAGACACTTCCCAATGCTCAAGCTGTTAAAGATCTCCGCTCC
AAGATGGACGGTGACGTTGGTGTAGCTCTGAAGAAGGCCAAGATGATTAAGGTTAAGCTCGAGGCGCTTGATAGATCCAA
TGCTGCTAACCGGAGCCTCCCAGGCTGTGGACCTGGATCCTCCTCGGATCGTACCCGGACGTCTCTTCTCAATGGTCTGA
GGAAGAAGTTGAAGGACTCGATGGATAGTTTTAACCGCTTGAGGGAGCTTATCTCGTCTGAGTATAGAGAAACTGTACAG
AGGAGGTACTTCACCGTCACCGGCGAGAATCCTGACGAGAAAACTTTGGATCGACTCATTTCTACAGGAGAAAGTGAGAG
GTTCTTGCAGAAAGCAATACAAGAACAAGGAAGAGGAAGGGTCTTAGACACCATTAACGAGATCCAAGAAAGGCATGATG
CGGTTAAAGACATTGAGAAAAATCTCAGAGAGCTTCACCAAGTGTTTCTAGACATGGCCGTGTTGGTCGAGCACCAGGGA
GCTCAGTTAGATGACATCGAGAGCCACGTGGGCCGAGCTAGCTCCTTTATTCGAGGCGGAACAGAGGAACTACACACCGC
TCGGGTTTACCAGAAGAACACCCGTAAATGGACATGTTACGCCATTATCATTCTCATCATCATCATAGTTGTTGTGGTTC
TTGCTGTTGTTAAACCATGGCAGACAAACGGAAGCGGAAGCGGAGGTGGAGGTGGCGGTGGCGGTGGAGGAAGTCCGCCA
GCTCAAGGTCAAGTGCCACCACCAAGTCCTCCTCAGGCAAGGCGTCTTCTGTTACGTTGA