Details for Chinese cabbage Locus Brara.E02899

Position : A05 ( 5`- 24636852 .. 24640665 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02899

Protein [Map View]
MASMMQPQIILLKEGTDTSQGKAQLLSNINAVTAVGDVVRTTLGPRGMDKLIHDDKGSVTISNDGATIMKLLDIVHPAAK
ILVDIAKSQDSEVGDGTTTVVLLAAEFLKEAKPFVEDGVHSQNLIRSYRTASTLAIEKVKELAVSIEGKSVEEKKGLLAK
CAATTLSSKLIGGEKEFFATMVVDAVMAIGDDDRLNLIGIKKVPGGNMRDSFLVDGVAFKKTFSYAGFEQQPKKFDNPKI
LLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVESGAKVVLSRLAIGDLATQYFADRDIFCAGRVAEQ
DLNRVAAAAGGTVQTSVNNIIPEVLGTCEIFEEKQVGGERFNIFSGCPSGRTATIVLRGGADQFIEEAERSLHDAIMIVR
RAVKNSTVVPGGGAIDMEISKYLRQHSRTIAGKSQLFINSYAKALEVIPRQLCDNAGFDATDVLNKLRQKHAMQSGEGAS
YGVDINTGGIADSFANFVWEPAVVKINAINAATEAACLILSVDETVKNPKSESAQGDAAAGAMGRGRGGGRGRGMRRR*

DNA
ATGGCGTCGATGATGCAACCGCAGATCATACTGCTGAAGGAAGGCACAGACACTTCTCAGGGGAAAGCGCAGCTTCTGAG
CAACATCAACGCCGTCACGGCGGTTGGCGACGTGGTTCGAACCACGCTCGGGCCTCGAGGGATGGACAAGCTCATCCACG
ACGACAAGGGATCCGTCACCATTTCCAACGACGGCGCTACTATTATGAAGCTCCTCGACATCGTACATCCCGCCGCTAAG
ATCCTCGTCGATATCGCCAAATCTCAAGACTCAGAGGTTGGTGATGGGACGACGACGGTTGTTCTTCTTGCTGCTGAGTT
TTTGAAGGAAGCTAAGCCGTTTGTTGAGGATGGTGTTCACTCTCAGAATCTGATTAGGAGTTATCGCACTGCAAGCACTT
TGGCAATTGAGAAGGTGAAAGAACTCGCTGTTAGCATTGAGGGGAAGAGTGTGGAGGAGAAGAAAGGTTTGTTGGCTAAA
TGTGCTGCGACCACGCTTTCCTCTAAGCTTATTGGTGGAGAAAAGGAGTTTTTCGCTACTATGGTTGTTGATGCTGTTAT
GGCCATTGGGGATGACGACAGGCTCAATTTGATTGGGATCAAAAAGGTTCCTGGTGGTAACATGCGAGACTCTTTCCTAG
TTGATGGTGTGGCCTTCAAAAAGACTTTCTCGTATGCGGGTTTTGAACAACAGCCGAAGAAGTTTGATAATCCCAAAATC
CTACTGCTTAACATTGAACTGGAGTTGAAATCTGAGAAGGAAAACGCTGAGATTAGGCTGTCAGATCCATCGCAGTACCA
GTCAATAGTTGATGCAGAGTGGAATATCATTTATGACAAGCTAGACAAATGTGTCGAAAGTGGAGCTAAAGTTGTTCTTT
CCCGATTGGCTATTGGTGATCTAGCTACCCAGTATTTTGCGGATCGTGATATTTTCTGCGCTGGCCGTGTAGCAGAACAA
GATCTTAATCGCGTGGCTGCTGCGGCCGGAGGAACAGTTCAAACAAGTGTTAACAATATAATACCCGAGGTTCTTGGAAC
TTGTGAGATATTTGAGGAAAAACAAGTTGGTGGGGAGAGGTTTAACATATTCAGTGGTTGTCCTTCAGGGCGTACAGCTA
CTATTGTCCTCCGTGGTGGTGCTGATCAGTTCATCGAAGAAGCTGAGCGTAGTTTGCATGATGCTATTATGATTGTGAGA
AGAGCTGTGAAGAACTCAACTGTTGTACCTGGAGGTGGAGCTATAGATATGGAGATAAGCAAGTACCTGAGGCAGCATTC
ACGAACAATTGCTGGGAAGTCACAACTTTTCATCAACTCGTATGCAAAGGCCCTGGAGGTTATTCCACGACAGCTATGTG
ACAATGCTGGATTTGATGCAACTGATGTCCTAAATAAATTAAGACAGAAACACGCCATGCAAAGCGGTGAAGGAGCTTCT
TACGGAGTAGACATCAACACTGGTGGAATAGCGGACTCATTTGCTAACTTCGTGTGGGAACCAGCTGTTGTGAAGATTAA
TGCTATAAACGCTGCAACTGAGGCAGCGTGCCTTATCCTAAGTGTGGATGAAACCGTGAAGAACCCTAAATCTGAGAGCG
CACAGGGAGATGCTGCCGCTGGTGCTATGGGAAGAGGACGCGGTGGAGGTCGTGGCCGTGGTATGCGCAGGCGATGA