Details for Chinese cabbage Locus Brara.E02897

Position : A05 ( 5`- 24629904 .. 24632614 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02897

Protein [Map View]
MESPSTKDLIQCCDCGCHSSPRSFHRSVKRRHDELLDHDESNNPKVHIENECELLRETVTSQQQSIQELYEELEKERNAA
ASAADESMNVMQRLQNEKAELQMELRQYKLYVGEKMEHDLQEMVALEELVNQREQTIMALTCEAQAYKHRMMSYGLTEGE
AEGDKSGYNSSDGYDLTAYEYPPLKCNVVENHDPLGGDVYVADDGKYPPVVSPLKSLDQRISEMETNPGFAELDGGFSGG
VKEKMVVGGQSPRPQRHFRRMSTKEVRTDAYVESPKKVANVSSYTENVNAKDDSSDIGDDRVYTIDSVTEQKLEAETSDG
NIGFQREQMYLGDPDITKLYMRLQALEADRESMKQALVSMRTEKAQMVLLKEIAQHLSKEVVPQRRLPLRKASTGGPLPF
TPVFKWISSFVSWRRKARRSKYMYGMSANNMGLQMLLEKVPRSRKWRCLRSTQV*

DNA
ATGGAGTCTCCTTCCACCAAAGATCTAATCCAATGCTGCGACTGTGGATGCCACTCCTCTCCACGCTCCTTCCACCGCTC
CGTGAAACGCAGACACGACGAGCTGCTTGACCACGACGAATCCAACAACCCCAAAGTCCACATCGAGAACGAGTGCGAGC
TCCTCCGAGAAACCGTCACCAGCCAGCAGCAATCTATCCAGGAGCTCTACGAGGAGCTCGAGAAGGAGAGGAACGCTGCA
GCTTCGGCTGCGGACGAGTCCATGAACGTGATGCAGAGGCTGCAGAACGAGAAGGCAGAGCTTCAGATGGAGCTGAGGCA
GTACAAGCTCTACGTTGGGGAGAAGATGGAGCACGATTTGCAGGAGATGGTGGCGTTGGAGGAGTTGGTGAATCAGAGGG
AGCAGACTATAATGGCGTTGACGTGTGAGGCTCAGGCTTATAAGCATAGGATGATGAGTTATGGGTTAACGGAGGGTGAG
GCTGAGGGGGACAAGAGTGGTTATAACTCGAGTGATGGTTATGATCTTACTGCTTATGAGTATCCTCCTTTGAAGTGTAA
TGTGGTTGAGAATCATGATCCTCTGGGGGGTGATGTATATGTTGCTGATGATGGGAAGTATCCGCCTGTTGTTTCGCCTT
TGAAGAGTTTGGATCAGAGGATCAGCGAGATGGAGACTAATCCTGGCTTTGCTGAGCTGGATGGTGGTTTCTCCGGTGGT
GTTAAGGAGAAGATGGTGGTTGGTGGTCAGAGTCCAAGGCCTCAACGACATTTTAGGAGGATGTCTACTAAAGAAGTTAG
GACTGATGCTTATGTTGAGTCTCCTAAGAAAGTGGCTAATGTCTCCTCATATACAGAGAATGTTAATGCTAAAGATGATT
CATCTGATATAGGAGATGATAGAGTTTACACCATTGATTCTGTAACTGAGCAGAAGCTTGAGGCGGAGACTTCTGATGGC
AATATTGGGTTCCAGAGGGAGCAGATGTATCTTGGTGATCCGGATATAACGAAGCTTTACATGAGGCTTCAAGCACTGGA
AGCTGACAGGGAATCGATGAAGCAGGCGCTTGTTTCTATGAGGACTGAGAAGGCTCAGATGGTGCTGTTGAAAGAGATTG
CTCAACATTTGTCAAAGGAAGTTGTGCCTCAACGAAGGTTGCCTCTAAGGAAAGCATCCACTGGTGGGCCATTGCCTTTC
ACGCCAGTCTTTAAGTGGATCTCTTCTTTTGTTTCCTGGAGAAGAAAGGCTCGTAGAAGCAAGTATATGTATGGGATGTC
AGCAAACAACATGGGACTGCAAATGCTTCTAGAAAAGGTCCCTAGATCAAGGAAATGGCGATGCCTCAGGAGCACGCAAG
TGTGA