Details for Chinese cabbage Locus Brara.E02894

Position : A05 ( 5`- 24601497 .. 24612123 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02894

Protein [Map View]
MTSILVDFIITIFGALDPTRQSLTMVTPPPLDQQEDEEMLVPHSDVVEGPQPMEVAQPEAAAAATAVESPPVEEPPTMKY
TWTIPGFTRLNTRKHYSDVFVVGGYKWRVLIFPKGNNVDNLSMYLDVADAANLPYGWSRFSQFGLAIVNQINSSYSIRKE
SQHQFNSRESDWGFTSFMPLSELYDPTRGYLLNDTVVIEAEVAVRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTL
YHIPYFRKAVYHMPTTENDAPTASIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKM
KGTVVEGTIQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCKDVYESFGKYVEVERLEGDNKYHAEGHDLQDAKK
GVLFIEFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLELDLDRDNRKYLSPDADKSVRNLYTLHSVLVHSGGVHGGHYY
AFIRPTLSDQWYKFDDERVTKEDVKRALEEQYGGEEELPQNNPGFNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKD
IAEHLRVRLKKEQEEKEEKRKYKAQAHLFTTIKVARDEDITEQIGKNIYFDLVDHEKIKSFRIQKQTPFQLFKEEVAKEF
GVPVELQRFWIWAKRQNHTYRPNRPLLPHEELQTVELLREACNKTNNAELKLFLEIERGPEERPIPPPDKSSEDILLFFK
LYDPENAILRYVGRLMVKNSSKPMDIVGQLNQMAGFAPDEEIELFEEIKFEPCVMCEQLDKKISFRLSQIEDGDIICFQK
PLSIQENECPYPDVPSFLAYVQNREVVRFRTLEKTKEDEFTMELSKLHTYDDVVQRLAEKLGLDDPSKIRLTSHNCYSQQ
PKPQPIKYRGVDRLSDMLAHYNQTSDILYYEVLDIPLPELQGLKSLKVAFHHTTKDEVVIHNIRLPKQSTVGDVINELKT
KVELSHPDAELRLLEVFFHKIYKIFSSTERIENINDQYWTLRAEEIPEEEKNIGPSDRLVHVYHFTKEAGQNQAQVQNFG
EPFFLVIHEGETLEEIKSRIQKKLRIPDEDFAKWKFASFSMGRPDYLQDTDVVYDRFQRKDVYGAWEQYLGLEHVDNAPK
RAYAANQNRHAYEKPVRIYN*

DNA
ATGACTAGCATACTTGTCGATTTCATCATCACCATTTTCGGCGCTCTCGATCCCACCCGTCAATCGCTCACTATGGTGAC
TCCACCGCCGCTTGATCAGCAAGAGGACGAGGAAATGCTCGTTCCGCATTCTGATGTGGTGGAGGGACCTCAGCCGATGG
AAGTTGCTCAACCTGAGGCTGCTGCTGCTGCTACCGCTGTGGAGAGTCCTCCAGTGGAGGAGCCTCCCACTATGAAGTAC
ACGTGGACTATCCCAGGTTTCACTAGGCTGAACACCAGGAAGCATTACTCTGATGTATTTGTTGTTGGAGGGTATAAATG
GAGAGTGTTGATTTTTCCCAAAGGAAACAATGTTGACAATTTGTCCATGTACTTGGATGTTGCGGACGCTGCTAATTTGC
CCTACGGGTGGAGCAGATTTTCGCAGTTCGGCCTGGCTATAGTGAATCAAATCAACAGCAGCTATTCCATCAGAAAAGAG
AGCCAGCATCAATTCAATTCAAGAGAAAGCGACTGGGGGTTTACATCATTCATGCCTCTCAGCGAGCTTTATGATCCCAC
TCGTGGATATTTATTGAATGATACTGTTGTAATTGAAGCTGAAGTTGCTGTGCGGAAGGTGCTTGATTACTGGTCATATG
ACTCAAAAAAAGAGACTGGTTTTGTTGGACTAAAGAACCAAGGTGCTACCTGTTACATGAATTCTCTCCTGCAGACGTTA
TACCACATACCTTACTTCAGAAAGGCTGTTTACCACATGCCAACAACTGAGAATGATGCACCTACGGCGAGTATCCCATT
GGCGCTCCAGAGTTTGTTTTACAAGCTTCAATATAATGACACCAGTGTAGCGACAAAGGAGCTGACCAAGTCGTTTGGTT
GGGATACATATGATTCGTTCATGCAACATGATGTTCAAGAACTCAACCGAGTTCTCTGTGAAAAGCTTGAGGACAAAATG
AAGGGAACTGTTGTGGAGGGAACAATACAGAAGTTATTCGAGGGTCACCACATGAATTACATAGAGTGCATCAATGTAGA
TTACAAATCTACACGGAAAGAATCATTCTATGACCTCCAGCTTGATGTTAAAGGCTGCAAAGATGTATATGAATCTTTTG
GCAAGTATGTTGAAGTTGAACGCCTTGAAGGTGACAACAAATACCATGCAGAAGGACATGATTTACAGGATGCAAAAAAG
GGTGTTCTGTTTATAGAATTTCCACCCGTACTTCAACTTCAGCTCAAGAGGTTTGAATATGATTTTATGCGAGACACAAT
GGTGAAGATAAATGATCGATATGAGTTTCCTCTTGAATTGGATCTTGACAGAGATAATAGAAAGTATTTATCCCCTGATG
CGGACAAGAGTGTCCGTAATCTATACACACTCCACAGTGTCTTAGTTCATAGTGGTGGAGTGCATGGAGGCCACTATTAT
GCTTTTATTAGGCCAACTCTCTCAGACCAGTGGTATAAATTTGATGATGAACGGGTGACGAAGGAAGATGTGAAAAGAGC
GCTGGAAGAGCAATATGGTGGTGAAGAAGAGTTGCCGCAGAATAATCCCGGTTTCAATAACCCACCTTTTAAATTCACAA
AATACTCGAACGCGTACATGCTTGTTTATATTCGGGAAAGCGACAAGGATAAAATAATCTGCAACGTTGATGAAAAAGAC
ATTGCAGAACATTTACGGGTGAGGCTGAAAAAAGAACAAGAAGAAAAGGAAGAGAAAAGAAAATACAAGGCTCAAGCTCA
CCTTTTCACGACAATCAAGGTCGCAAGAGATGAAGACATTACTGAGCAAATTGGAAAGAATATATATTTTGATCTTGTTG
ATCATGAAAAAATCAAGAGTTTCCGAATTCAGAAACAGACCCCCTTTCAACTATTTAAGGAAGAGGTGGCCAAAGAATTT
GGTGTCCCGGTTGAGCTACAGCGGTTCTGGATTTGGGCAAAGCGGCAGAACCATACTTATCGGCCCAACCGCCCCCTATT
ACCTCATGAAGAATTACAGACGGTTGAACTTTTAAGAGAGGCATGTAACAAGACAAACAATGCTGAACTAAAGCTGTTTC
TGGAAATAGAGCGCGGACCGGAGGAGCGTCCTATTCCTCCCCCAGACAAGTCATCTGAAGATATTCTCCTTTTCTTTAAG
CTCTATGACCCTGAGAATGCAATTCTAAGATATGTTGGTAGGCTCATGGTGAAAAATTCCAGTAAGCCCATGGACATAGT
AGGGCAATTGAATCAAATGGCTGGCTTTGCTCCTGATGAGGAAATAGAACTTTTTGAGGAAATAAAGTTTGAACCTTGTG
TCATGTGCGAACAACTGGATAAGAAGATTTCTTTCAGACTATCTCAAATTGAAGATGGAGATATCATATGCTTTCAGAAA
CCTCTTTCTATCCAGGAGAATGAATGTCCTTACCCGGATGTACCATCGTTTTTGGCGTATGTACAGAATCGAGAGGTGGT
GCGCTTTCGTACTCTCGAAAAAACAAAAGAAGACGAGTTCACTATGGAGTTGTCAAAGCTGCACACGTATGATGATGTTG
TCCAAAGATTAGCTGAGAAGCTTGGCCTTGATGATCCATCGAAAATTAGGCTTACTTCTCACAATTGCTACTCCCAGCAA
CCCAAGCCCCAGCCTATTAAATACCGTGGAGTAGACCGTCTTTCAGATATGTTAGCTCACTATAATCAGACGTCTGACAT
TTTGTATTATGAAGTTCTGGACATTCCTCTTCCAGAATTGCAAGGTCTTAAGAGTCTAAAAGTAGCTTTCCATCATACCA
CAAAGGACGAGGTGGTAATCCACAATATCAGACTTCCTAAACAGAGTACTGTGGGAGATGTTATTAACGAACTTAAAACA
AAGGTGGAGTTGTCGCATCCTGATGCAGAACTGAGGTTGCTGGAGGTCTTTTTCCACAAGATCTACAAGATCTTTTCATC
TACGGAAAGAATTGAGAATATCAATGACCAGTACTGGACTTTACGAGCAGAGGAGATACCTGAGGAAGAGAAGAATATTG
GTCCCAGTGATCGATTAGTCCATGTGTACCATTTTACTAAAGAGGCCGGACAAAATCAAGCGCAAGTACAAAATTTCGGC
GAGCCGTTCTTTTTGGTAATCCACGAAGGTGAAACTTTAGAAGAAATCAAGTCCCGTATCCAAAAGAAGCTCCGTATACC
AGATGAGGACTTCGCCAAGTGGAAGTTTGCTTCTTTCTCAATGGGACGTCCGGACTACTTGCAGGACACAGATGTCGTTT
ATGATCGCTTTCAGAGAAAGGATGTCTATGGTGCCTGGGAGCAGTATCTTGGGTTGGAGCACGTTGATAATGCTCCTAAA
AGGGCTTATGCTGCAAATCAGAACCGACACGCATACGAGAAGCCGGTGAGAATATACAATTAG