Details for Chinese cabbage Locus Brara.E02890

Position : A05 ( 5`- 24585464 .. 24588017 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02890

Protein [Map View]
MDPPVSDPDKINNQKEAGPSFHCPLYDTQLVHKISLTFLPGLATACVDNTTGDIFKTPGSVAADVKQEMIEYLNHRSETF
VADHILLSSSSEIEPSSHDPYDVVSDFVDDFATSKRNLFSRVSGWLLSERREDNIDDFAQEMEVSGFWLNDHIEGIAQTL
LKNVDFKGLSHCEMKFQTQGELEEHVLTCGYRTMDCGNEGCNAVFCANQRESHDGVCPFKIIPCEQGCLESGGIMRREMD
RHCITVCTMKLVNCAFRGVGCLDDVRQCEVQQHFLDSVGSHLMCVLKGMYKEASLDDLKPRAEEILQLSTRLSEARNARA
LTNLVKEIDAKLGALVIKPKKEKKALEEAEIKGKPETASEKIPEDKVVSKEAEVVVDDAMVEEVGKKVSEAEIGENVDKE
GELKAQKLLEMDEFVKEGEDSSAADLSERTETKAPEVVVMDEDKEEEKSPETRTNETRGVETEAKDVIDEENHKEAKISA
ETKSEAPSTIVMDKEEGAETKQTRIIETKGVETKVNDMIDEENNRETKISAETKSEVPSRIAMENEEGAETKQTRTNESK
GVETEVNDVIDEENKKETNVSAETKSESLMDKEENEEGAETKQTRTNETRGVETEANDVIGEENNRETKISDETKREAPS
SIVMDKEENEKGAETINSSASASDEAEALSKSSEGFSKAQAETE

DNA
ATGGATCCACCAGTGTCAGATCCTGACAAAATCAACAACCAGAAAGAAGCAGGACCTTCCTTCCACTGCCCTCTCTACGA
CACACAGCTCGTCCACAAGATCTCCCTCACTTTCCTCCCCGGCCTCGCCACCGCCTGCGTCGACAACACCACCGGAGACA
TCTTCAAGACCCCTGGCTCCGTCGCCGCCGACGTCAAACAAGAAATGATCGAGTACCTCAACCACAGAAGCGAAACCTTC
GTGGCTGACCACATCCTCCTCTCCTCATCGTCAGAGATCGAACCTTCCTCTCACGACCCTTACGACGTCGTATCGGACTT
CGTCGACGACTTCGCCACCTCCAAGAGGAACCTCTTCAGCCGCGTCTCCGGGTGGCTCCTCAGCGAGAGGAGGGAGGACA
ACATTGATGACTTCGCGCAGGAGATGGAGGTCAGCGGCTTCTGGCTGAATGATCACATCGAAGGAATAGCTCAGACGTTG
CTTAAAAATGTAGACTTCAAAGGTCTTTCTCATTGCGAGATGAAGTTTCAAACACAAGGAGAGCTTGAGGAGCATGTGCT
GACTTGTGGTTACAGGACGATGGACTGCGGGAACGAAGGGTGTAATGCTGTCTTCTGCGCGAACCAGAGGGAGAGTCATG
ATGGCGTTTGCCCGTTTAAGATTATTCCGTGCGAGCAGGGGTGTTTGGAGAGTGGTGGTATCATGAGGCGTGAGATGGAT
AGGCATTGTATTACTGTGTGTACTATGAAGCTTGTGAACTGTGCGTTTCGTGGTGTTGGTTGTTTGGATGATGTGCGTCA
GTGTGAGGTTCAGCAGCATTTTTTGGATAGTGTGGGGTCTCATCTGATGTGTGTTCTCAAAGGTATGTATAAAGAAGCGT
CTTTGGATGATCTCAAACCTCGAGCTGAAGAGATACTGCAGTTGTCTACGCGGTTGTCTGAAGCTCGAAATGCAAGAGCG
CTGACGAATCTTGTTAAGGAGATTGATGCAAAGCTGGGGGCTTTAGTGATCAAACCAAAGAAGGAGAAGAAAGCTTTAGA
AGAAGCTGAGATCAAAGGGAAACCAGAGACAGCTAGTGAGAAGATTCCGGAAGATAAAGTGGTTTCAAAGGAAGCAGAGG
TTGTGGTAGATGATGCAATGGTGGAAGAAGTTGGGAAGAAAGTTTCAGAAGCTGAGATAGGAGAGAATGTTGACAAAGAA
GGCGAGCTTAAAGCTCAGAAGCTTTTGGAAATGGACGAGTTCGTCAAAGAAGGAGAGGACAGCTCTGCAGCTGATTTGTC
AGAGAGAACTGAAACCAAAGCTCCGGAAGTTGTGGTGATGGATGAAGATAAGGAAGAGGAGAAGAGTCCAGAGACGAGAA
CAAATGAAACCAGAGGTGTAGAGACTGAAGCTAAGGACGTGATTGATGAAGAGAATCATAAAGAGGCAAAGATATCAGCT
GAAACCAAAAGTGAAGCTCCCTCAACAATAGTCATGGACAAGGAGGAAGGAGCAGAGACAAAACAGACAAGAATAATTGA
AACCAAAGGTGTAGAGACTAAAGTTAATGACATGATTGATGAAGAGAATAATAGAGAGACAAAGATATCAGCTGAAACCA
AAAGCGAAGTTCCCTCAAGAATAGCCATGGAGAATGAGGAGGGAGCAGAGACAAAACAGACGAGAACAAATGAAAGTAAA
GGTGTAGAGACTGAAGTCAATGACGTGATTGATGAAGAGAATAAAAAAGAGACAAATGTATCAGCTGAAACCAAAAGCGA
GTCTCTCATGGACAAGGAGGAGAATGAGGAGGGAGCAGAGACAAAACAGACGAGAACAAATGAAACCAGAGGTGTAGAGA
CTGAAGCTAATGATGTGATTGGTGAAGAGAATAATAGAGAGACGAAGATATCAGATGAAACCAAAAGGGAAGCTCCCTCA
AGCATAGTCATGGACAAGGAGGAGAATGAAAAGGGAGCAGAGACAATCAACTCAAGTGCTAGTGCTTCTGATGAAGCTGA
AGCATTGTCAAAGAGCTCAGAAGGTTTCTCTAAAGCACAAGCTGAAACCGAA