Details for Chinese cabbage Locus Brara.E02881

Position : A05 ( 5`- 24521845 .. 24523498 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02881

Protein [Map View]
MKTPPRRSKRGDQESELHKVTTPVALRAAREKKHCSKARAVRVRPEYPLTRTTPEMKIMPPEFFQIDALDLAPRLLGKLL
RRDNVVLRITEVEAYRPNDSACHGRFGNTPRTAPIFGPGGHAYVYLCYGLHMMLNIVADKDGVGAAVLIRSCSPVTGLET
IQERRGQKTDKPVLLNGPGKVGQALGLSTEWSHHPLYSPGGLEVLDGGEDVEKVLVGPRVGIDYALPQHVNALWRFAIGD
TPWISAPKNTLKPL*

DNA
ATGAAAACGCCGCCTCGTCGTTCCAAGCGAGGTGATCAGGAATCGGAACTACACAAGGTTACAACTCCAGTGGCTCTACG
TGCAGCACGAGAGAAGAAGCACTGTTCCAAGGCTCGGGCGGTTCGGGTCAGACCCGAGTACCCACTGACCCGCACCACCC
CCGAGATGAAGATAATGCCTCCTGAGTTCTTTCAAATAGACGCGCTTGATCTTGCGCCGCGTTTGCTCGGGAAGTTACTG
AGGAGAGACAATGTTGTCCTACGGATCACAGAGGTAGAAGCTTATAGACCAAATGATTCAGCTTGCCATGGACGGTTCGG
GAATACCCCACGTACCGCACCTATTTTTGGACCAGGAGGACATGCCTATGTTTATCTTTGTTACGGTCTTCATATGATGC
TCAATATTGTTGCGGATAAGGATGGAGTTGGAGCCGCTGTTTTGATACGATCTTGTTCTCCTGTTACCGGGCTGGAGACC
ATACAGGAGCGTCGTGGCCAGAAAACCGACAAACCTGTTCTTCTAAATGGACCAGGAAAGGTCGGGCAGGCGCTTGGACT
TTCAACAGAGTGGTCTCATCATCCCCTCTATTCTCCGGGAGGATTGGAGGTTCTGGATGGAGGAGAAGATGTGGAGAAAG
TACTAGTTGGTCCTCGCGTTGGAATAGATTACGCATTGCCTCAACATGTCAATGCCTTGTGGAGATTTGCCATTGGAGAC
ACTCCGTGGATAAGTGCTCCTAAGAACACTCTTAAGCCTCTCTAA