Details for Chinese cabbage Locus Brara.E02878

Position : A05 ( 5`- 24505423 .. 24509106 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02878

Protein [Map View]
MASLLDSLTTRNFFSKPIISRISSPSSSFASSSSSNISPFSPPSVLSYSHKRSHSRFPYPVAATLDGPSVEEDELEFEES
EEDSFPDESDEEDDLSIDISILEKEARDIVRDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQTQIPEHLLQRVAIVG
RPNVGKSALFNRLVGENKAIVVDEPGVTRDRLYGRSYWGDQEFVVVDTGGVMTVSKSPAGVMEELNVSTTIGMEGIPLSS
REAAVARMPSMIEKQATAAVEESDVIVFVVDGQTGPTGADVEIADWLRKYYSHKNIILAVNKCESPRKGLMQASEFWSLG
FSPIPISALSGTGTGELLDLVCSGLNKLEIMETMEEEEEENYIPAIAIIGRPNVGKSSILNALVREDRTIVSPVSGTTRD
AIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEAMSVNRAFRAIRRSDVVALVIEAMACITEQDMKIAERIEREGKG
CLVVVNKWDTIPNKNQQTAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTATLNQVIREAV
AFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLRTDAGFAGTPIRLLWRSRKRSDKNGGGGG
TMRMSSLSRERNLATKRS*

DNA
ATGGCGAGTCTACTTGACTCACTCACAACCAGAAACTTCTTCTCTAAACCCATAATCTCTAGGATCTCCTCTCCTTCATC
TTCCTTTGCTTCTTCTTCTTCTTCGAATATCTCACCCTTTTCTCCTCCCTCCGTTCTCTCTTACTCTCACAAAAGGTCGC
ATTCTCGCTTCCCTTACCCTGTCGCAGCAACTCTCGATGGTCCCTCCGTTGAAGAAGACGAGCTAGAGTTCGAGGAATCC
GAAGAAGACAGCTTCCCTGATGAGTCGGATGAAGAAGATGACCTCTCCATAGATATCTCAATTCTTGAGAAAGAAGCGAG
AGACATCGTTAGAGACTACGCTACTACTCTGTCTCGCGAGCTCAAACTCGAGGATGATGTAGTTGAAGGGAAGGAGTCAC
GTAGAAAGGGGAAGAGGCAAGCCAAAAATAACCAGACGCAGATACCAGAGCATCTTCTCCAAAGAGTTGCCATCGTTGGA
AGGCCCAATGTGGGCAAATCAGCTTTGTTCAACCGTCTTGTTGGGGAGAATAAAGCGATAGTGGTGGATGAGCCTGGAGT
TACTAGGGATAGACTGTACGGTAGATCCTACTGGGGTGACCAAGAGTTTGTGGTGGTGGACACTGGTGGTGTTATGACTG
TTTCTAAGTCGCCAGCTGGTGTTATGGAAGAGCTTAACGTTTCGACCACCATTGGCATGGAAGGTATACCATTAAGCTCC
AGGGAGGCAGCTGTTGCGAGAATGCCTTCCATGATTGAGAAGCAAGCTACAGCGGCTGTTGAAGAGTCAGATGTTATTGT
TTTCGTTGTTGATGGCCAGACAGGGCCTACAGGTGCTGATGTGGAGATTGCAGACTGGTTGCGGAAGTATTACTCACATA
AGAATATCATCCTCGCGGTGAACAAATGTGAATCGCCACGTAAAGGACTCATGCAGGCTTCAGAGTTTTGGTCTCTTGGG
TTTTCACCCATCCCTATTTCCGCATTGTCGGGAACTGGAACAGGAGAGCTACTTGATCTTGTTTGTTCTGGACTAAACAA
ACTCGAGATCATGGAGACCATGGAAGAGGAGGAAGAAGAAAACTACATACCTGCCATTGCAATTATAGGCAGGCCAAATG
TTGGGAAAAGTAGCATTTTGAATGCACTTGTCCGAGAGGATAGAACAATTGTTAGCCCTGTTAGTGGCACTACCCGTGAT
GCTATCGATGCTGAGTTTACCGGACCAGATGGAGAGAAGTTTAGGCTAATAGATACAGCTGGGATTAGGAAAAAGGCAGC
TGTGGCTTCATCAGGGAGCACTACAGAGGCCATGTCAGTGAATCGTGCATTCCGAGCAATTCGACGTTCTGATGTGGTTG
CTCTTGTCATTGAAGCCATGGCATGCATAACAGAGCAGGACATGAAGATTGCAGAAAGAATAGAAAGAGAAGGGAAAGGA
TGTCTGGTAGTAGTAAACAAATGGGATACAATACCAAACAAAAACCAACAGACTGCAGCACATTACGAGGATGATGTTAG
GGAGAAGCTCCGTTCCCTCAAATGGGCACCCATTGTTTATTCTACTGCTATAACTGGACATAGCGTTGACAATATTGTGG
TTGCTGCTGCGACGGTTCAAAAGGAGAGATCAAGAAGACTTAGTACCGCTACATTGAACCAAGTGATTAGAGAAGCTGTT
GCGTTTAAATCCCCTCCAAGAACCAGAGGAGGCAAACGAGGCCGTGTTTATTATTGCACTCAGGCAGCAATAAGGCCACC
GACGTTTGTGTTCTTTGTAAACGATGCAAAGCTGTTTTCGGATACGTACAGAAGATATATGGAGAAGCAGCTACGCACTG
ATGCAGGCTTTGCTGGGACTCCTATTCGTCTTCTTTGGCGCAGCCGTAAGAGATCTGACAAAAATGGAGGAGGTGGAGGT
ACAATGAGAATGTCAAGTCTTTCACGTGAGAGAAATCTTGCAACAAAAAGGTCATAA