Details for Chinese cabbage Locus Brara.E02877

Position : A05 ( 5`- 24504057 .. 24505798 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02877

Protein [Map View]
MYRFSNTVIGVLNLLSLLASIPIIGAALWKARSSTTCENFLQTPLLVIGFIILLVSLAGFIGACFNVAWALWVYLVVMIF
LIATLMGLTLFGLVVTSQGGGVEVPGRVYKEYRLGDYHPWLRERVRDPQYWISIRSCILSSKTCAQIESWTTLDYFQRDM
TSVQSGCCKPPTACTYDTGVIVGGEDCYRWNNGIETLCYECDACKAGVLEEIRLDWKKLSVVNILVLVLLIAVYAAGCCA
FHNTRHAAHPYHPSDDNRMTKVRPRWDYYWWRWWHEKKEQLY*

DNA
ATGTACAGATTCAGCAACACAGTGATTGGAGTCTTAAACCTCCTCAGCTTACTAGCTTCAATACCAATCATAGGAGCCGC
TCTATGGAAGGCAAGAAGCAGCACAACTTGCGAAAACTTCCTCCAGACTCCTCTACTCGTTATAGGTTTCATCATACTCT
TAGTATCTCTCGCCGGATTCATAGGAGCCTGTTTCAACGTGGCATGGGCTCTTTGGGTTTACCTAGTGGTCATGATCTTC
CTCATCGCGACTCTAATGGGTCTAACTCTGTTTGGTCTGGTGGTGACTAGCCAAGGAGGCGGTGTGGAAGTACCAGGGAG
GGTTTATAAAGAGTATAGGCTTGGTGATTATCATCCATGGTTGAGAGAGAGAGTTAGAGATCCTCAGTATTGGATCTCTA
TAAGAAGCTGTATCTTGAGTTCCAAGACTTGTGCTCAGATTGAATCCTGGACTACACTTGATTATTTCCAAAGAGACATG
ACTTCTGTTCAGTCGGGATGTTGTAAGCCACCGACGGCGTGCACGTACGATACCGGAGTAATAGTAGGAGGAGAAGATTG
CTATAGATGGAACAATGGTATTGAAACGTTATGCTACGAGTGTGATGCTTGCAAAGCTGGTGTTCTTGAGGAGATCCGTC
TTGACTGGAAAAAGTTGTCGGTCGTTAATATTCTGGTCCTTGTCCTCCTCATCGCTGTCTACGCTGCAGGTTGCTGCGCC
TTCCACAACACTCGTCACGCAGCTCATCCTTATCATCCTTCTGATGATAACCGCATGACGAAAGTCCGTCCTCGTTGGGA
CTATTACTGGTGGAGATGGTGGCATGAAAAGAAAGAGCAGCTTTACTAA