Details for Chinese cabbage Locus Brara.E02873

Position : A05 ( 5`- 24490311 .. 24492232 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02873

Protein [Map View]
MDARKRGRPEAGSFNSNGGGFKKSKQEMESGLGSKSKPCTKFFSTSGCPFGENCHFLHFVPGGYNPMAQMTNMGSPMSQV
SRNMQGSGGGGGGGRFSGRGESGPGHVSSFGASATAKISVDASLAGAIIGKGGVCSKQICRQTGAKLSIQDHERDPNLKN
IELEGTFEQINEASAMVRELIGRLNSASRRPPGGGGGGGGLGSEGKPHPGSNFKTKMCERFSKGSCTFGDRCHFAHGEAE
LRRS*

DNA
ATGGATGCTCGTAAGAGGGGACGGCCTGAAGCTGGCTCATTCAACTCCAATGGCGGCGGATTCAAGAAGTCGAAGCAAGA
GATGGAATCTGGTTTAGGAAGCAAATCGAAGCCATGCACAAAATTTTTCAGCACTTCTGGCTGTCCTTTTGGTGAGAACT
GCCATTTCTTGCACTTTGTTCCCGGAGGATACAATCCTATGGCACAGATGACAAACATGGGATCACCCATGTCTCAAGTT
TCCAGAAACATGCAAGGATCTGGTGGTGGTGGTGGTGGGGGCAGATTTTCAGGGAGAGGAGAGTCAGGGCCTGGCCATGT
CTCTAGCTTTGGTGCCTCAGCCACAGCCAAGATCAGTGTGGATGCTTCCTTGGCAGGCGCAATCATTGGAAAAGGTGGAG
TCTGTTCGAAACAGATATGTCGTCAGACAGGAGCGAAGCTATCGATCCAAGATCACGAGAGAGATCCCAACCTGAAGAAC
ATTGAGCTTGAAGGAACATTCGAGCAGATAAACGAAGCGAGCGCAATGGTTAGAGAGCTGATTGGGAGGCTTAATTCTGC
ATCTAGGAGACCACCTGGTGGTGGTGGTGGTGGCGGTGGGCTTGGTTCAGAAGGGAAACCGCATCCAGGAAGCAACTTCA
AGACGAAGATGTGTGAGAGATTCTCAAAAGGAAGCTGTACATTTGGTGATAGATGTCACTTTGCTCACGGGGAAGCAGAG
CTACGCAGGTCATGA