Details for Chinese cabbage Locus Brara.E02867

Position : A05 ( 5`- 24468480 .. 24469822 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02867

Protein [Map View]
MKLLIRLSIFFAALFISSLPSSYSCNPKDKNTLLQIKKHFNNPKLLSSWDPQTDCCTSWTGIECTNGRVTLFSMASDDSV
VGQIPDQIGDLPELRTLEMSSMNLTGNIPRTITKLKHLVLIFLSWNKLSGPIPDYVSELKSVTFLDISFNKFTGPIPGWL
TQMPKLQTFQADNNSLTGPIPNSFGSFVGNVPNVFLPYNKLSGKIPESLSKIDFQAIVLKGNGFTGDGSMFFGGNKRTVQ
LDLSRNLFEFDLSKVKFGKSMALLDLSHNRIFGTLPRELTELRLERFNISYNRLCGKIPRGGQLQTFKSYEFAENRCLCG
SPLKKAC*

DNA
ATGAAGCTCCTTATTCGTCTCTCTATCTTCTTCGCTGCACTCTTCATCTCTTCTCTCCCATCATCTTACAGCTGCAACCC
AAAAGACAAAAACACCCTCCTTCAAATCAAGAAGCATTTTAACAACCCGAAACTCCTCTCCTCCTGGGATCCTCAAACCG
ACTGTTGTACTAGCTGGACAGGCATTGAGTGCACTAACGGCCGCGTCACATTATTCTCTATGGCCAGCGACGACAGCGTC
GTCGGTCAGATCCCGGACCAGATCGGCGACCTCCCTGAACTCCGTACACTCGAAATGAGTTCCATGAATCTAACCGGAAA
CATACCACGCACCATCACCAAACTCAAGCACCTCGTCCTCATCTTCTTAAGCTGGAACAAACTATCCGGTCCAATTCCTG
ATTACGTCAGCGAGCTCAAAAGCGTTACGTTCTTGGACATCTCCTTTAACAAGTTTACCGGTCCTATTCCCGGTTGGCTT
ACTCAGATGCCTAAGCTTCAGACCTTTCAGGCCGACAACAATTCGCTAACCGGTCCTATACCGAACTCTTTCGGTTCCTT
TGTAGGCAACGTCCCTAATGTTTTCTTGCCTTACAATAAGCTCTCAGGAAAAATACCGGAGTCATTATCAAAGATCGACT
TTCAAGCAATAGTTTTGAAGGGAAATGGTTTCACAGGAGATGGTTCGATGTTTTTCGGAGGGAACAAAAGAACAGTACAA
TTGGATCTGTCGAGAAATTTGTTTGAGTTCGATCTCTCCAAGGTTAAGTTCGGTAAGAGCATGGCTTTGTTGGATCTGAG
CCATAACCGAATCTTCGGGACGCTTCCTAGGGAACTGACTGAGCTACGTCTCGAGCGTTTCAACATTAGTTACAATCGTC
TATGCGGAAAAATCCCACGTGGTGGTCAACTTCAGACCTTTAAATCATATGAATTCGCTGAGAACCGCTGTCTTTGTGGG
TCCCCACTTAAGAAGGCTTGTTAA