Details for Chinese cabbage Locus Brara.E02859

Position : A05 ( 5`- 24428864 .. 24434264 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02859

Protein [Map View]
MEEVQPPVTPPIDPNGKRSEAVLLELCEKVLSLEGSICDEALKLFTETKPILSANMANIGSGTREEVERFWFAFVLYSVK
MLTVRKQVDGQSVSGDNKFNLCQILRALKLNIVDFFKELPQFVVKAGPVLCELYGADWESRLQAKELQANFVHLSLLSKY
YKRGYREFFLTYDANAEMTSANSASYLPDSYRFGWLLFLALRNHAFSRFKDLVTCTNGLVSILGILILHVPCRFRNFSIQ
DSSRFVKKGEKEVDLVASLCKIYDASEDELRKIMDQANNLIETILKKKPSSASTCKIDKLDNINPDGLTYFEDLLDEASI
STSLITLEKDYEDSVCNKGELDERVFINEEDSLLGSGSLSAGAVNVTGVKRKIDSLSSPARTFITFDLCKVIESFIRHED
SLPRELRRHLNSLEERLLESMVWEKGSSMYNSLIVARPLLALEINRLGLLAEPMPSLDAIAALINFSEGSNHAPSIQKHE
TCPGQNGDMKSPKRQCTDYRSILVERNSFTSPVKDRLLAFGNVKSKMLPPPLQSAFASPTRPNPGGGGETCAETGINIFF
TKINKLAAVRINGMVERLQLSQQIRESVYRLFQHVLAQRTSLLFNRHIDQIILCCFYGVAKISQMSLTFREIIYNYRKQP
QCKPLVFRSVYVDSHQSRRQGQGRVGPDHVDIITFYNEIFIPAVKPLLVEIIPVKKDQAMEANNKPEGHCPGSPKVSVFP
SVPDMSPKKVSAVHNVYVSPLRGSKMDALISHSSKSYYACVGESTHAYQSPSKDLSAINNRLNNCSTNRKRTLKFDAEAG
LVSDSMVGNSLYLQNQNGSDASSSGGAPLKTEPVDSS*

DNA
ATGGAAGAAGTTCAGCCACCAGTGACCCCACCCATTGACCCCAATGGGAAAAGAAGTGAAGCAGTTCTCTTGGAGTTATG
CGAGAAAGTTCTGTCTCTTGAAGGGAGCATTTGCGATGAAGCTTTGAAGTTGTTTACTGAAACCAAACCGATTTTGTCGG
CAAACATGGCTAACATTGGAAGTGGAACGCGGGAGGAAGTAGAGAGGTTCTGGTTTGCGTTTGTTCTCTACTCAGTGAAG
ATGCTTACTGTTAGAAAACAAGTGGACGGCCAGTCAGTTTCTGGTGATAATAAGTTTAATCTATGTCAGATACTGAGGGC
TCTAAAGCTCAATATTGTGGATTTCTTTAAAGAGTTACCTCAATTTGTAGTCAAGGCTGGCCCTGTGCTATGTGAACTTT
ATGGCGCAGACTGGGAGAGCAGACTTCAGGCAAAGGAGCTTCAAGCAAACTTTGTGCATCTTAGCCTTCTAAGCAAATAC
TACAAACGTGGGTACCGGGAGTTTTTCTTGACATATGACGCAAACGCAGAAATGACCTCAGCGAACTCTGCTAGTTATTT
GCCAGATAGTTACCGTTTTGGGTGGTTACTCTTTTTGGCACTACGAAACCATGCTTTTAGTCGATTTAAAGACCTTGTGA
CATGCACCAATGGCCTAGTTTCTATATTGGGTATTTTGATCCTACACGTCCCTTGTCGGTTTAGAAATTTCAGCATCCAA
GACTCTTCACGTTTTGTTAAGAAAGGTGAAAAAGAGGTAGACTTGGTTGCATCACTTTGCAAGATATATGACGCCTCAGA
AGATGAGTTGAGGAAAATAATGGACCAGGCAAATAATCTGATAGAAACAATATTGAAGAAGAAGCCATCCTCAGCATCCA
CTTGCAAAATTGACAAGCTAGATAATATTAACCCAGATGGCTTGACTTACTTTGAGGATTTACTGGATGAGGCATCCATC
TCAACTAGCTTGATCACACTAGAAAAAGATTACGAAGATTCAGTCTGCAATAAAGGCGAACTGGATGAGAGGGTGTTCAT
CAATGAAGAGGATAGCTTACTCGGATCCGGAAGCTTATCTGCAGGAGCTGTAAATGTTACTGGTGTCAAGAGGAAAATTG
ATTCTTTGAGCTCACCTGCGAGGACATTTATAACCTTTGATCTCTGCAAGGTTATAGAGAGTTTCATTAGACACGAGGAT
TCTCTACCTAGAGAGTTGAGACGGCATCTGAACTCACTTGAGGAACGGCTTCTCGAGAGTATGGTTTGGGAGAAAGGCTC
TTCAATGTACAACTCCCTGATCGTTGCCAGGCCATTGCTTGCGTTGGAGATCAACCGGCTCGGATTGCTAGCTGAACCGA
TGCCATCTCTAGATGCAATTGCAGCTCTTATTAACTTCTCCGAAGGATCAAATCATGCACCATCTATCCAAAAGCATGAA
ACATGTCCAGGACAAAATGGGGATATGAAATCGCCCAAAAGACAGTGTACAGATTACCGCAGCATTCTAGTTGAACGCAA
TTCCTTTACATCACCGGTAAAGGATCGTCTGTTGGCCTTTGGCAACGTTAAATCAAAGATGCTGCCACCTCCGTTGCAGT
CTGCCTTTGCTAGTCCGACACGGCCAAACCCAGGAGGCGGTGGAGAAACTTGTGCTGAAACTGGTATCAATATTTTCTTC
ACTAAGATTAATAAACTGGCTGCTGTCAGAATCAATGGAATGGTGGAAAGGTTACAACTGTCGCAGCAAATAAGGGAGAG
TGTATATCGTCTCTTCCAACATGTACTTGCTCAGCGGACTTCTCTTTTATTTAATCGGCATATTGACCAGATCATTCTCT
GTTGCTTTTACGGAGTGGCCAAGATATCCCAAATGAGCCTAACTTTCAGGGAAATCATATACAACTATAGGAAGCAACCA
CAGTGTAAACCACTAGTTTTCCGCAGCGTTTATGTGGATTCGCATCAGAGTCGCCGTCAAGGTCAAGGGAGAGTGGGGCC
AGATCATGTAGACATCATCACATTCTACAACGAAATATTTATTCCTGCCGTAAAGCCGTTGCTGGTGGAGATAATTCCTG
TGAAAAAGGACCAGGCTATGGAGGCCAATAATAAACCTGAAGGTCATTGTCCTGGATCGCCAAAGGTGTCGGTGTTTCCA
AGTGTTCCAGACATGTCCCCTAAAAAAGTATCTGCTGTGCACAATGTTTATGTTTCTCCCCTTCGGGGATCAAAGATGGA
TGCTCTTATTTCACACAGCTCAAAGAGTTACTATGCTTGTGTTGGAGAGAGCACACATGCTTACCAGAGCCCTTCAAAAG
ACCTATCTGCCATCAACAACCGCTTGAACAACTGCAGCACCAACCGCAAGAGGACGCTTAAATTTGACGCGGAAGCAGGA
CTGGTCAGTGATTCCATGGTAGGAAACAGCCTTTACCTCCAAAACCAAAATGGAAGCGATGCATCGTCTTCAGGTGGTGC
ACCCCTTAAAACCGAGCCAGTAGATTCATCATAG