Details for Chinese cabbage Locus Brara.E02858

Position : A05 ( 5`- 24426527 .. 24428483 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02858

Protein [Map View]
MASSDQTAKIIDGKAIAHTIRSEIAEEVRDLSEKHGKVPGLAVVIVGARKDSQTYVNMKRKACAEVGIKSVDVDLPEDVS
EADLISKVHQLNSDPDVHGILVQLPLPKHINEENVLSAISIDKDVDGFHPLNIGKLAMKGREPLFLPCTPKGCLELLKRS
GVKIKGQRAVVVGRSNIVGLPVSLLLLKADATVTTVHSHTKDPEAIIREADIVIAAAGQACMIKSDWIKPGAAVIDVGTN
AVSDPSRKSGYRLVGDVDYAEACKVAGSITPVPGGVGPMTVAMLLRNTLDGAKRVIGQ*

DNA
ATGGCTTCATCTGATCAAACGGCGAAGATAATCGATGGAAAGGCGATTGCTCATACCATCCGATCAGAGATCGCCGAGGA
AGTTCGCGATCTATCTGAGAAACACGGCAAGGTCCCAGGACTAGCGGTAGTTATAGTTGGTGCACGGAAAGATTCACAAA
CTTATGTGAATATGAAGAGGAAAGCGTGTGCTGAGGTTGGGATCAAATCAGTTGATGTGGACCTACCAGAGGATGTTTCT
GAAGCTGATCTTATCAGCAAAGTTCATCAACTCAATTCAGATCCTGATGTCCACGGTATATTAGTTCAACTCCCATTGCC
GAAACATATCAATGAGGAGAATGTTTTAAGTGCAATCAGCATTGATAAGGATGTAGATGGCTTCCATCCTCTGAATATTG
GTAAGCTAGCCATGAAAGGCAGAGAGCCCCTCTTCCTTCCCTGCACCCCTAAGGGATGTTTGGAACTCTTAAAGAGAAGT
GGCGTAAAGATAAAAGGGCAACGAGCAGTCGTAGTAGGTCGGAGTAACATCGTTGGATTGCCTGTTTCGCTTCTATTGCT
CAAGGCTGATGCTACTGTTACAACCGTACATTCTCACACCAAAGATCCTGAGGCTATCATACGGGAAGCTGACATCGTTA
TTGCTGCAGCCGGACAAGCCTGCATGATTAAGAGCGACTGGATTAAGCCAGGGGCTGCGGTGATCGATGTTGGAACTAAT
GCAGTGAGCGACCCGAGCAGGAAGTCAGGATACCGGTTGGTTGGAGATGTGGATTACGCAGAAGCTTGTAAAGTTGCAGG
TTCCATAACTCCTGTCCCTGGTGGTGTAGGTCCAATGACAGTGGCGATGCTGCTGAGGAACACCTTAGACGGTGCCAAGC
GGGTCATTGGCCAGTAA