Details for Chinese cabbage Locus Brara.E02857

Position : A05 ( 5`- 24418630 .. 24420358 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02857

Protein [Map View]
MDCYSGMKFEELAVPNYQESSSSETYRSDGMWGGWSMNSPEAAETCFNYDGFNGEGSLYSQMGMRTSEEEEETKRSKAFY
GASSLHDFEGIEQMDDIFLSSILEDVPGNDGDVHRASSSYNSVGSSSMYGGNEVHMFHCHDMPMKEEAPFTISDLSEENM
LDSQYGDELSSEELVLQDLQRASGKLTDETRKCFRDTFYRLARNSQEKFDSVSTNTEEFYMPASRYAYGDSTRMSREEEI
ESGTNSIDRAVANLTYNKMDSNISNFPLSERVQ*

DNA
ATGGATTGTTATTCCGGAATGAAGTTTGAAGAGCTTGCTGTACCCAATTATCAAGAGTCATCGTCATCAGAGACATACCG
TTCTGATGGTATGTGGGGTGGGTGGAGCATGAACTCCCCTGAAGCTGCAGAGACATGTTTTAATTACGATGGTTTTAATG
GGGAAGGATCGTTGTATAGTCAGATGGGTATGAGGACGAGTGAAGAAGAGGAAGAGACAAAGAGATCAAAGGCTTTCTAC
GGTGCTTCTTCACTTCATGATTTCGAAGGAATCGAACAGATGGATGATATATTCTTAAGTTCAATTTTGGAGGATGTTCC
AGGGAATGATGGAGATGTTCATCGTGCTTCCAGCAGCTATAACAGTGTCGGATCTTCCTCTATGTATGGTGGAAATGAAG
TTCACATGTTCCATTGTCATGACATGCCTATGAAGGAGGAGGCTCCATTTACAATCTCAGATCTGTCTGAAGAGAACATG
TTAGATTCACAGTATGGTGATGAACTGTCTTCTGAAGAACTTGTGTTGCAGGATCTGCAGAGAGCTTCAGGAAAGTTAAC
TGATGAGACAAGAAAGTGTTTCCGGGATACGTTTTACCGGCTTGCAAGAAACTCACAGGAGAAGTTTGATTCAGTCAGCA
CCAACACAGAAGAGTTCTATATGCCAGCATCCAGATATGCTTATGGTGATAGTACCAGGATGAGTAGAGAGGAAGAGATT
GAATCAGGAACAAACTCAATCGATAGAGCCGTCGCAAACCTCACATACAACAAGATGGATTCCAACATAAGCAACTTTCC
TCTATCAGAAAGAGTACAGTAG