Details for Chinese cabbage Locus Brara.E02856

Position : A05 ( 5`- 24417209 .. 24417745 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02856

Protein [Map View]
MAITPLRITTPFPSQPFLPAAKPHASKLFTVRATDVESTEETPQPDSDTEDFESRLSNIRLRYRSGTGKKAEVRKSKKGS
AGPPSKSSGLYLPPVSLKEPVSGGLKVELGFTPYTERLNGRMAGLGLVALLLVELATGKSLLSYHTPSVVWLQVYFMAAV
SAMFVKIEKEKVSVWPKD*

DNA
ATGGCGATAACTCCTCTACGAATCACGACCCCTTTCCCATCTCAACCCTTTCTCCCAGCCGCAAAGCCACACGCTTCAAA
GCTCTTCACGGTCCGCGCCACCGACGTCGAATCAACGGAAGAGACTCCTCAACCCGACTCAGACACCGAAGACTTCGAGT
CACGTCTCTCGAACATCCGTCTCAGATACCGAAGCGGAACGGGGAAGAAAGCAGAGGTGAGGAAATCCAAGAAAGGCTCA
GCAGGGCCACCGTCGAAAAGCTCGGGACTTTACTTGCCGCCGGTGAGTTTAAAGGAGCCGGTTTCGGGCGGGTTGAAGGT
GGAGTTGGGGTTTACGCCTTACACGGAGCGGCTCAACGGGAGGATGGCGGGGTTGGGGCTCGTGGCTTTGCTTCTGGTGG
AGCTGGCGACGGGGAAGAGCTTGTTGAGTTACCACACGCCTTCAGTTGTGTGGCTTCAGGTGTATTTCATGGCGGCTGTT
TCGGCTATGTTTGTTAAGATTGAGAAGGAGAAGGTTAGTGTCTGGCCTAAGGATTAA