Details for Chinese cabbage Locus Brara.E02854

Position : A05 ( 5`- 24411735 .. 24412464 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02854

Protein [Map View]
MSSLRRALLVAGKTKLNLQNCHFITGINYNGLTVKQLQELRGILRENSNTKLLVAKNTLVFKALEGTKWESLKPCMKGMN
AWIFVQTEDIPAALKTFVSFQKEKKLFDNNLGGAVFEEKLYAPQDYKVIETMPSREDVYGMMFGGLHWPGLDLVNTLEAP
AASENESAAA*

DNA
ATGTCCAGCCTCAGAAGAGCCCTCCTCGTCGCCGGCAAAACGAAGCTCAACCTCCAGAACTGCCACTTCATCACCGGGAT
CAACTACAACGGCCTCACCGTCAAGCAGCTCCAAGAGCTCCGCGGGATCCTCCGCGAAAACAGCAACACGAAGCTCCTCG
TGGCCAAGAACACTCTCGTCTTCAAGGCCCTGGAAGGGACCAAATGGGAGTCTCTGAAGCCGTGTATGAAAGGCATGAAC
GCCTGGATCTTCGTTCAGACCGAGGATATCCCCGCGGCTCTGAAGACGTTCGTCAGTTTCCAGAAGGAGAAGAAGCTCTT
CGATAATAACTTGGGAGGTGCCGTGTTCGAGGAGAAGCTGTACGCTCCTCAGGATTATAAGGTTATTGAAACGATGCCGT
CTCGGGAAGATGTGTATGGGATGATGTTTGGGGGTTTGCATTGGCCCGGGTTGGATCTCGTCAATACGTTGGAGGCGCCT
GCTGCATCGGAGAATGAGAGTGCTGCTGCTTAG