Details for Chinese cabbage Locus Brara.E02853

Position : A05 ( 5`- 24407878 .. 24411322 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02853

Protein [Map View]
MPIVSKTRRQTDYNLFPPSVPIVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKATGETVTIVGDQDPAMMKFFDCTRS
GPRSAFDSNVVYQFEIMEYILDFAFDRLGASGSAIDHPILITECVGNPVYSRSKMAELLFETYGVPSVAFGVDAAFSYKY
NQRHGKCKKDGIVICPGFTTTHTIPFVDGEPVYKGSCRTNIGGYHVTDYLKQLLSLKYPFHSSIFTWEKAEELKLEHCFI
APDYVSEARKFQEGTKEAEEKTRYWQLPWIPPPVEVPPSEEEIARKAAIREKQGQRLREMAEAKRSSKINEMENELHSLH
FLVKQLDQVEEDDIPSFLSDTGYASRQELESTVSKVTQALRKARGEPKDEADEFEENTDSNEKYPLINVPDNMLTPEQIK
DKKKQLFLKTTTEGRLRARQKRNEEELEKERRNQLEEERRRENPEFYLEEMRAQYKEVLERVEQKKRLKTNGSNTNGNQK
SGNVGRGERLSAAKRERMRLLTTAAFDRGKGEDTFGAKDEDWQLYKLMSKDHDEDDERPDSDEAELARLSSRLQEIDPTF
EQKAEGEPGQASGEAPRVRPLTEEDYKIVIGVERFRCPEILFHPNLVGIDQVGLDEMVGASIRRLPHDDDKELEEKLTSS
ILMTGGCSLVPGMKKRLECGIRMIRPCGSTINVVQAKDPVLDAWRGASAFAADLNFLGNAFTKKDYYEKGEEWLRSYQIQ
YNTL*

DNA
ATGCCGATCGTCTCGAAGACACGTAGGCAGACTGATTACAACCTCTTTCCACCTTCGGTTCCCATTGTTATCGATAATGG
CGCATCCTACTTCCGGATCGGGTGGGCAGGCGAAACTGAGCCTCGTGTTGTTTTCCGCAATATCGTGCAAAGACCACGCC
ACAAAGCTACAGGAGAAACTGTTACGATTGTTGGGGACCAGGATCCTGCGATGATGAAGTTCTTTGATTGCACTCGCTCG
GGACCTCGTTCGGCTTTTGACAGCAATGTTGTTTATCAATTCGAGATCATGGAATATATCCTTGACTTCGCCTTTGATCG
ATTGGGGGCTAGTGGATCAGCGATTGATCATCCAATCCTGATTACAGAATGCGTTGGCAACCCAGTTTATTCTCGTAGCA
AAATGGCAGAACTTCTATTTGAGACTTATGGAGTGCCTTCAGTTGCATTTGGAGTGGATGCTGCTTTCAGCTACAAGTAC
AATCAACGACATGGGAAATGTAAAAAAGATGGAATTGTTATCTGCCCTGGCTTCACTACAACACACACCATTCCATTTGT
GGACGGAGAACCTGTTTATAAAGGATCCTGCAGAACTAACATTGGTGGATATCATGTCACTGATTATTTAAAGCAGCTTC
TGTCACTCAAGTACCCTTTTCATTCGTCTATATTTACATGGGAGAAGGCAGAAGAGTTGAAACTGGAACACTGTTTCATC
GCTCCTGATTACGTTTCTGAAGCTCGGAAATTCCAGGAAGGAACAAAGGAAGCTGAGGAGAAAACAAGGTATTGGCAGCT
TCCATGGATACCTCCTCCCGTCGAAGTCCCTCCATCAGAAGAAGAGATTGCTAGGAAGGCAGCTATAAGAGAGAAACAAG
GACAAAGGCTACGAGAAATGGCTGAAGCAAAGAGATCTTCCAAGATAAACGAAATGGAAAACGAACTGCACAGCTTGCAC
TTCCTTGTGAAGCAGCTTGACCAGGTTGAAGAGGATGACATTCCATCTTTTTTGTCAGACACCGGTTACGCTTCGAGGCA
AGAGCTGGAGTCTACTGTCTCGAAGGTGACGCAGGCGCTTAGAAAAGCAAGGGGTGAGCCGAAGGATGAAGCTGATGAGT
TCGAAGAGAACACTGATTCTAACGAAAAGTATCCTCTTATAAACGTCCCTGACAATATGCTTACACCTGAGCAGATTAAA
GACAAGAAGAAACAGCTATTTCTTAAAACAACAACAGAGGGAAGGCTACGAGCTAGACAAAAGCGTAATGAGGAGGAACT
GGAGAAAGAGAGAAGAAATCAATTAGAGGAGGAGAGACGTCGTGAGAATCCAGAGTTCTATTTAGAGGAGATGCGAGCTC
AGTACAAGGAAGTGTTGGAGAGAGTCGAGCAAAAGAAACGGCTGAAAACAAACGGATCAAACACAAACGGGAATCAAAAA
TCTGGAAACGTTGGCCGAGGGGAACGACTAAGCGCTGCAAAGAGAGAAAGAATGCGTCTGCTAACGACAGCAGCCTTTGA
CCGAGGCAAGGGAGAGGATACGTTTGGTGCTAAAGACGAAGATTGGCAGCTCTACAAACTTATGAGCAAGGATCACGACG
AAGACGACGAAAGACCTGACTCAGACGAAGCTGAGCTGGCTCGTTTATCGTCCAGGCTCCAGGAGATAGACCCAACGTTT
GAGCAGAAAGCGGAAGGAGAGCCGGGACAGGCATCAGGGGAGGCTCCACGTGTTCGTCCACTAACGGAGGAAGACTACAA
GATAGTGATCGGTGTGGAAAGATTCAGGTGTCCAGAGATCTTGTTCCATCCTAACCTCGTTGGGATTGACCAAGTGGGGT
TAGACGAGATGGTCGGTGCATCTATCAGAAGGCTACCACACGATGATGATAAAGAGTTAGAGGAGAAGCTAACAAGCTCG
ATACTGATGACCGGTGGGTGCAGCCTTGTCCCGGGGATGAAAAAACGGTTGGAATGCGGGATAAGGATGATAAGACCGTG
TGGCTCAACCATAAATGTGGTTCAAGCTAAGGATCCAGTGTTGGACGCGTGGCGTGGAGCATCTGCGTTTGCTGCTGATT
TGAACTTCTTGGGGAATGCGTTTACCAAGAAGGATTACTACGAGAAAGGTGAAGAGTGGCTTCGAAGTTACCAGATTCAA
TACAACACTTTGTGA