Details for Chinese cabbage Locus Brara.E02851

Position : A05 ( 5`- 24403265 .. 24404519 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02851

Protein [Map View]
PRVVIIAAKSLELFFQELCDRTYEITLERGAKTVSSLHLKHCVETYNVFDFQREVVSKVPDYGQAQGQSQGNATMKPISD
EVNDSDEEYKKSKMTAMVEQPPPQDSIQVDVSVSSPQENEKKDRRIDIDLNAESHDLNETKLAPATDTATASEEYPGWRT
MAKIDPAHFASLGKRIDEDEEG*

DNA
CCAAGAGTTGTTATTATTGCAGCAAAGTCTTTGGAATTGTTCTTCCAAGAACTTTGCGATCGTACGTATGAGATTACCCT
TGAAAGAGGAGCCAAAACCGTGAGCTCATTGCACCTCAAACACTGTGTGGAAACATATAACGTGTTTGATTTTCAGAGGG
AAGTTGTGAGCAAGGTGCCTGACTATGGCCAAGCGCAAGGGCAGAGCCAGGGTAATGCTACCATGAAGCCGATCAGTGAC
GAAGTGAATGACAGCGACGAGGAATATAAGAAAAGCAAAATGACCGCCATGGTGGAACAGCCACCTCCTCAAGACAGCAT
CCAGGTGGACGTGTCAGTGTCATCACCACAAGAGAACGAGAAGAAGGATAGAAGGATTGACATTGATCTCAATGCTGAAT
CTCACGACCTGAACGAGACCAAACTAGCACCAGCCACAGACACAGCCACGGCCTCAGAGGAATATCCAGGATGGCGTACG
ATGGCCAAAATAGATCCAGCACACTTTGCAAGTTTAGGTAAAAGAATAGACGAGGACGAAGAAGGCTGA