Details for Chinese cabbage Locus Brara.E02849

Position : A05 ( 5`- 24399941 .. 24401377 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02849

Protein [Map View]
MKTCLLLFLIFSLLLSFSSAEQCGRQAGGALCPNGLCCSEFGWCGNTEPYCKQPGCQSQCGGTPPGPTGDLSGIISRSQF
DDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQN
PSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQCGRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTPQSPKPSCHAV
IVGQWQPSDADRAAGRVPGYGVITNIINGGLECGGGQDARVADRIGFYQRYCNILGVNPGGNLDCYNQRSFASVNFFLNA
AI*

DNA
ATGAAGACTTGTCTACTTCTCTTTCTCATCTTCTCACTTCTCCTATCATTTTCCTCAGCCGAGCAATGTGGTCGACAAGC
CGGAGGAGCTCTCTGCCCCAACGGTCTATGCTGCAGTGAGTTCGGATGGTGCGGTAACACCGAACCTTACTGTAAGCAGC
CTGGCTGCCAAAGCCAGTGCGGTGGTACTCCTCCTGGCCCCACCGGTGATCTTTCAGGCATCATTTCAAGATCTCAGTTC
GATGACATGCTTAAACATAGAAATGATAATGCTTGTCCCGCTAGAGGTTTCTACACTTATGATGCCTTTATCAATGCCGC
TAAGTCTTTCCCTGGCTTCGGCACCACCGGAGACACCGCCACAAGGAAGAAAGAAATCGCTGCCTTCTTTGGTCAGACTT
CCCACGAGACCACCGGTGGGTGGGCCACAGCACCAGACGGACCATATTCATGGGGCTACTGTTTCAAACAAGAGCAGAAC
CCTTCTTCAAACTACTGTTCACCGAGTGCAGAATGGCCATGCGCATCTGGTAAAAGCTACTACGGAAGAGGACCAATGCA
GCTATCATGGAACTACAACTACGGACAGTGTGGAAGAGCCATCGGATCTGACTTACTTAACAACCCTGACCTTGTCTCCA
ACGATCCAGTGATCGCTTTCAAAGCCGCGATTTGGTTCTGGATGACACCTCAGTCTCCAAAACCGTCGTGCCACGCCGTG
ATCGTCGGCCAATGGCAGCCTTCGGATGCTGACAGGGCTGCCGGGAGAGTACCGGGTTACGGTGTGATTACGAATATCAT
TAACGGTGGTTTAGAGTGTGGAGGCGGCCAAGACGCTAGAGTCGCGGATAGAATTGGATTTTACCAGAGGTACTGTAACA
TTCTTGGAGTTAATCCTGGAGGTAACCTTGATTGTTATAACCAAAGGTCCTTTGCTTCTGTTAATTTCTTCCTTAACGCT
GCTATTTAA