Details for Chinese cabbage Locus Brara.E02848

Position : A05 ( 5`- 24395244 .. 24397469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02848

Protein [Map View]
MNLEDLLEGQQSVADLLDHHRRLNRQELQNQVSQNSSIKSEEEKSDDLLKKKQKLRLQRDVMKMQGELEEEQALNKALRG
ILRGPVMSQPRLSLLLLPPEVQEIIEELATVEAEITCLEKKIQDLKHDVYSERKVNQELEAKYDEREERMMMMTTPKKLL
QRQNQLPWEPDSDIPKMRSIDLKQRSKLQSCEDPHGFKDIQMSSNPFSPRHSSSSTFSRMQDSKNIQMSNPFSPRHRSST
FSRMQDNKKGQGTTPNGVSEDLLKCLMGIYLELNKSSREREGSRTVSKLSLSHLKNASFKRKSVYGQNASNLDPYGVVMG
TCIRDIGEYKNFIHITRTCIDVSRLSDCSTALVNLRVLKEKLSKVDPSFLNHKKKMAFWINTYNACVMNGFLEHGLRSSK
EKLLTILKMATIDVGGTQLSALDIEGSILHSPCEPLETVSTDVHKRYGFRCDEPNLMFVLCRGDWSSPALRVYTAEDVVN
ELIKARTEYLEASIGISGRKKIVIPRFLHKRLREDFADDEGTLVEWICRQLPPGQRCLQLKETAMEWLKKQSESSLNKLI
EVRPHEYEFRYLLHL*

DNA
ATGAATCTTGAAGACTTACTTGAAGGTCAACAAAGTGTAGCGGATCTTCTTGATCATCATCGCCGTCTAAACCGCCAGGA
ATTACAAAACCAAGTAAGCCAAAACTCATCTATAAAGAGCGAAGAAGAGAAGAGTGATGACTTGCTAAAGAAGAAACAAA
AACTTCGTCTTCAAAGAGATGTGATGAAAATGCAAGGAGAGCTAGAGGAGGAGCAAGCACTCAACAAGGCCTTACGAGGT
ATACTTCGTGGACCAGTCATGTCTCAGCCTCGTCTCTCTTTACTGCTTCTTCCTCCTGAGGTTCAAGAGATAATAGAGGA
GCTTGCTACGGTTGAGGCAGAGATAACCTGCCTCGAGAAAAAAATCCAAGACCTGAAACATGATGTGTATAGTGAGAGGA
AAGTGAATCAAGAACTTGAAGCCAAATATGATGAAAGAGAAGAGAGGATGATGATGATGACTACTCCTAAGAAACTACTA
CAGAGGCAGAATCAACTTCCTTGGGAACCTGACAGTGACATTCCAAAGATGAGATCTATAGATCTAAAACAAAGATCCAA
GTTACAGAGTTGTGAAGATCCTCATGGTTTCAAGGATATCCAAATGAGCAGCAATCCCTTCTCACCAAGACACAGCAGTT
CTTCGACTTTTTCAAGAATGCAAGATAGCAAGAACATTCAAATGAGCAATCCCTTCTCACCAAGACACCGTTCTTCGACT
TTTTCAAGAATGCAAGATAACAAGAAAGGGCAAGGGACGACACCAAATGGAGTATCAGAAGATCTGTTGAAGTGCTTGAT
GGGAATCTATTTGGAACTCAACAAGTCATCGCGAGAGAGAGAAGGGTCAAGAACGGTTTCAAAGCTGAGCCTCTCACACC
TGAAGAACGCTTCTTTTAAACGCAAATCAGTGTATGGTCAGAACGCATCAAATCTTGATCCTTATGGAGTTGTGATGGGG
ACTTGTATCAGAGACATTGGAGAGTACAAGAACTTCATCCACATCACTCGAACTTGCATTGATGTTAGCCGGCTATCTGA
TTGCTCAACTGCTCTTGTCAATCTAAGGGTTTTGAAGGAGAAGTTGAGCAAAGTTGATCCGAGTTTCTTGAATCACAAGA
AAAAGATGGCGTTCTGGATTAATACCTACAACGCATGCGTCATGAATGGATTTTTGGAACATGGACTACGTTCATCAAAG
GAGAAACTACTGACGATTCTCAAAATGGCAACTATTGACGTGGGAGGTACGCAACTCTCTGCCCTAGATATTGAAGGATC
CATCTTGCATAGTCCATGCGAACCCTTGGAAACTGTAAGTACTGATGTACACAAACGGTACGGATTCAGATGCGATGAAC
CGAACCTAATGTTCGTGCTTTGTCGTGGAGATTGGTCTTCACCTGCATTGAGAGTCTATACAGCAGAAGATGTTGTCAAC
GAACTAATCAAAGCAAGAACGGAGTATTTAGAAGCCTCCATAGGTATCTCGGGGAGGAAAAAGATTGTGATTCCGAGATT
CTTGCACAAGCGTCTTCGAGAAGATTTCGCAGATGATGAAGGGACATTAGTTGAGTGGATATGCAGGCAGCTACCACCAG
GACAACGTTGCTTGCAGCTCAAGGAAACAGCAATGGAGTGGCTGAAGAAGCAAAGTGAGTCGTCTTTGAACAAATTAATA
GAAGTAAGGCCTCACGAATACGAGTTTCGCTATCTCTTACATTTGTAA