Details for Chinese cabbage Locus Brara.E02831

Position : A05 ( 5`- 24331321 .. 24333096 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02831

Protein [Map View]
MYKADALKINNKRTGTCYNLDSTSREERRAESPSGLVLTTDPKPRLRWTAELHERFVDAVTHLGGPDKATPKTIMRVMAV
KGLTLYHLKSHLQKFRLGKQPHKEHSHGHSTNIRDTNRASMLDLQRNVVFSTPNIIGRNMNEMQMEVKRRIEEEVEVERQ
VNQRIEAQGKYMESMLEKACETQEASLTKDYSTLFFNNTSPLPIPWFEDHFPSSSSMDSTLNLSDISLNFSLQDSRSSIT
KNRTVCLG*

DNA
ATGTATAAGGCAGATGCGTTAAAAATCAACAATAAAAGGACTGGGACATGCTATAATTTGGATTCAACGTCGAGGGAGGA
GAGGAGAGCCGAGTCACCATCAGGTCTCGTTCTCACCACCGACCCTAAACCTCGACTCCGCTGGACCGCTGAGCTTCATG
AACGTTTCGTTGACGCCGTCACTCACCTTGGAGGCCCTGACAAAGCTACACCAAAGACGATTATGAGAGTGATGGCTGTG
AAGGGTCTTACACTTTACCATCTCAAGAGCCATCTCCAGAAGTTCAGACTTGGAAAGCAGCCTCACAAGGAACATAGTCA
TGGTCACTCCACTAATATTAGGGATACTAATAGAGCTTCCATGTTGGATCTTCAAAGGAATGTTGTATTCAGTACTCCTA
ACATCATTGGTCGCAATATGAACGAGATGCAAATGGAAGTGAAAAGAAGAATAGAGGAAGAGGTAGAAGTAGAAAGACAG
GTGAATCAAAGGATAGAAGCACAAGGGAAATACATGGAGAGCATGTTGGAGAAAGCATGTGAAACACAAGAAGCAAGTCT
CACCAAAGACTACTCTACTCTCTTTTTCAACAACACATCACCCCTCCCAATTCCATGGTTCGAGGATCATTTTCCCTCGT
CTTCCTCCATGGATTCTACATTGAATCTTTCTGATATCAGTCTCAACTTCTCTCTCCAAGATTCTCGGAGCTCTATCACC
AAGAACCGTACGGTTTGTCTCGGTTAG