Details for Chinese cabbage Locus Brara.E02828

Position : A05 ( 5`- 24322490 .. 24324827 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02828

Protein [Map View]
MHKLSRSNRDKLQQFVAITGASDKNALQALKASDWQLEAAFDVFYSQPQPRSNGDMRRLEELYNRYKDPYSDMILAEGIS
VLCSDLQVEPQDIVTLVLSWHMNAATACEFSKEEFFGGLQALGVDSIGKLQEKLSFMRSELKDEQKFHEIYNFAFGWAKE
KGQKSLALDTAIGMWQLLFAEREWPLVNHWCDFLQDRHNKAISKDTWAQLLEFARTVDPALSNYDAEGAWPYLIDEFVEY
LYDKSVVEK*

DNA
ATGCATAAGTTGAGTAGAAGCAACCGGGATAAACTTCAGCAGTTCGTGGCTATCACTGGAGCTAGTGATAAGAATGCTCT
TCAGGCTCTCAAAGCCAGCGATTGGCAGCTGGAAGCAGCTTTTGATGTGTTTTACAGCCAGCCCCAGCCAAGAAGCAATG
GTGATATGAGACGCTTGGAGGAGCTCTACAATAGATATAAAGACCCATATTCTGATATGATTCTGGCCGAAGGTATCTCG
GTTCTGTGTAGTGATCTTCAGGTGGAACCCCAAGACATTGTCACGTTGGTTCTTTCGTGGCATATGAATGCTGCAACAGC
GTGTGAATTTTCCAAGGAAGAATTTTTTGGTGGATTACAGGCATTAGGCGTAGATTCCATTGGGAAGTTGCAGGAAAAGC
TGTCATTTATGCGTTCTGAGCTTAAAGATGAACAAAAGTTCCATGAAATATACAACTTTGCTTTTGGGTGGGCGAAAGAG
AAGGGACAGAAGTCTCTTGCTTTAGATACAGCTATTGGTATGTGGCAGCTGCTCTTTGCAGAAAGAGAGTGGCCATTAGT
AAACCACTGGTGTGATTTCTTACAGGATCGTCACAACAAGGCCATATCTAAAGACACATGGGCACAGCTCCTGGAGTTTG
CAAGGACGGTGGACCCGGCGCTGTCGAATTACGATGCAGAAGGAGCATGGCCTTACCTCATCGATGAGTTCGTTGAGTAC
CTGTATGACAAGAGCGTTGTTGAGAAGTAA