Details for Chinese cabbage Locus Brara.E02823

Position : A05 ( 5`- 24301976 .. 24310702 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02823

Protein [Map View]
MASRGGKSIPDSAMSSKGSKSRPDSDSKPKRHKTLEAPKEPRRPKTHWDHVIEEMIWLSKDFESERKWKLAQAKKVALRA
SKGMVDQASREERKLKEEEQRLRKVALNISKDVKKFWIKVEKLVLYKHQLVRNEKKKKAMDKQLEFLLGQTERYSTMLAE
NLVEPYKHGHNESPKPILAIESKSDEERAEETPSELNASAGLESETLDVDEDYDINPEDASEDDEDTIEEDEKHFTKQER
QEELEALQNEVDLPVEELLRRYTSGRVSGETSPERDENEANLASVGEDDIEGDKNNLTASEETEGSPSVRRSNDSFDHLA
VSETHTPDHKPGPKTASVKSGKEDQTYDFNDEQEDVDFVAATGEEKDDETTLSVEEELAKADSVDPEDEIALLQKESEMS
IEELLARYKEDFGGKDLSEDDSSDIRQQADSDDENVESAECKPALQPCSEKDEGTSNEIKEDDAKDSSDKIADAAAAARS
AQPTGFTYSTTKVRTKLPFLLKHSLREYQHIGLDWLVTMYEKRLNGILADEMGLGKTIMTIALLAHLACDKGIWGPHLIV
VPTSVMLNWETEFLKWCPAFKILTYFGSAKERKLKRQGWMKLNSFHVCITTYRLVIQDSKMFKRKKWKYLILDEAHLIKN
WKSQRWQTLLNFNSKRRILLTGTPLQNDLMELWSLMHFLMPHVFQSHQEFKDWFCNPIAGMVEGQDKINREVIDRLHNVL
RPFLLRRLKRDVEKQLPQKHEHVIFCRLSKRQRNLYEDFIASTETQATLNSGSFFGMISIIMQLRKVCNHPDLFEGRPIV
SSFDMPGIDVQLSSRICSLLLKSPFSRVDLEDLGFVFTHHDFSMTAWEGDEIKAISTPSDLIKQRVDLKDNPEEVPLSLV
NRKNLQGTSIFEEIRKAVFEERVKESKDRAAAIAWWNSLRCRRKPTYSTSLRTLLTIKGPLDDIRHLKANRPSYMYSSML
ADIVLSPIERFQKVIELVEAFTFAIPAARVPSPACWCSKSDSPIFLSPSYKEKVTDLLSPLLSPIRPAIVRRQVYFPDRR
LIQFDCGKLQELAMLLRKLKFGGHRALIFTQMTKMLDILEAFISLYGYTYMRLDGSTPPEERQTLMQRFNTNPKIFLFIL
STRSGGVGINLVGADTVIFYDSDWNPAMDQQAQDRCHRIGQTREVHIYRLISESTIEENILKKANQKRALDNLVIQNGEY
NTEFFKKLDPMELFSGHKTLTRKDEEEKSKNCEAELSLSNADVEAALKHAEDEADYMALKRVEEEEAVENQEFTEEPIER
PEDDELVNEDDIKSDEPADQGVAAAGSAKEEVSLVPIDNRDERDDIITLSQEEDNDVPDDVKQMAAAAAAAGQAISSFEN
QLRPIDRYAIRFLEVWDPIIVEAAIENEAGFEEKEWELDHIEKYKEEMEAEIDDGEEPLVYEKWDADFATEAYRQQVEVL
TQHQLMEDLENEAREREAAEEAERRLALNESAHVLKPKKKKKVKKAKYKSLKKGSLGSESKQAKTVVKVEASSDEDNEEC
GYVSSSDSDMVSPRLQKRMKGKKRELVFDSDEEKNSKKKAKKHKKSLSHSDIKCKTPHDELVPSKPSDSMAVDNELKPAN
RGKTLGKKFIISMPIKRVLMIKPEKLKKGNLWSRDCVPSPDSWLPQEDAVLCAMVHEYGSNWSLVSETLYGMTAGGAYRG
RHRHPAYCCERYRELMQRHVLSASDSVVNEKNLNAGSGKALLKVTEENMRALLNIAAEQPDTEMLLQKHFTCLLSSIWRT
STRSTNNQKLSLNSPIFNRQVMGSANHAQELARKPFQGMKITSLSSKLVESALQDSSTSQPVDTASRSRLQEDQPINKVG
LDLTLEFPRGNDDSSTHFPPIIKLTIDGSDSFNYVNDPPGEDKLKVSRIAAEDRYRNAANACIEDSFGWASNTFPAYDPK
SRSGVKAPSLGKHKLSASDTPKSSKSKQRKLSAAEQSEVAWVRRNDPNLKFDFTPADREEEEEDKEVSEEIEMIGCPHWY
DPLLTSGLDDCSLASEPSGIE*

DNA
ATGGCGTCTAGAGGTGGAAAGTCGATACCTGATTCAGCAATGTCGTCCAAAGGCTCCAAATCTCGACCTGATAGCGACTC
CAAACCTAAGCGACACAAGACGCTGGAAGCTCCTAAAGAGCCGCGACGACCTAAGACTCACTGGGACCATGTTATAGAGG
AGATGATTTGGCTCTCAAAGGATTTTGAGTCTGAGAGGAAGTGGAAGCTAGCTCAGGCAAAGAAAGTTGCTTTGAGGGCC
AGCAAAGGCATGGTAGATCAAGCTTCTAGGGAAGAAAGGAAGCTTAAGGAAGAAGAACAGAGACTGAGGAAAGTAGCCCT
TAATATCTCTAAAGACGTTAAAAAGTTTTGGATCAAAGTTGAGAAACTGGTGCTTTACAAGCATCAGCTAGTACGGAATG
AGAAAAAGAAGAAGGCTATGGACAAGCAACTTGAGTTTCTGTTAGGCCAGACTGAGAGGTACTCAACTATGTTGGCAGAA
AATTTAGTGGAGCCTTATAAACATGGCCACAACGAATCTCCAAAACCTATTCTGGCTATCGAATCAAAAAGTGATGAGGA
AAGGGCAGAAGAGACACCTTCGGAGTTGAATGCTTCTGCAGGTCTTGAATCAGAAACTCTTGATGTCGATGAGGATTATG
ATATCAATCCCGAGGATGCGTCAGAAGATGATGAAGATACTATTGAGGAGGATGAAAAGCACTTCACCAAACAGGAAAGG
CAAGAAGAGTTGGAAGCTTTGCAAAATGAAGTGGATTTACCAGTTGAGGAGCTACTCAGACGTTATACTTCTGGTAGAGT
TAGCGGAGAAACCAGCCCAGAAAGAGATGAAAATGAAGCTAATCTGGCATCAGTAGGTGAAGATGATATAGAGGGTGACA
AAAACAATCTTACAGCTTCTGAAGAAACTGAAGGGAGCCCAAGTGTTCGTCGTTCTAATGATAGCTTTGATCATTTAGCA
GTATCCGAGACCCATACACCTGATCACAAGCCAGGCCCAAAAACTGCCTCTGTGAAGTCCGGAAAGGAAGATCAGACCTA
TGATTTCAACGATGAACAGGAGGATGTTGATTTTGTTGCTGCCACTGGTGAGGAAAAGGATGATGAGACGACACTGTCCG
TTGAAGAGGAACTGGCAAAAGCAGATAGTGTGGACCCTGAGGACGAGATTGCTCTGCTACAGAAGGAGAGTGAAATGTCT
ATTGAAGAATTGCTTGCAAGGTATAAGGAGGATTTCGGTGGCAAGGATTTATCTGAAGATGATTCGTCAGATATCAGGCA
GCAAGCTGATTCAGATGACGAAAATGTTGAATCAGCCGAATGTAAGCCAGCTTTACAGCCTTGCTCAGAAAAAGATGAAG
GCACATCCAATGAAATAAAAGAAGATGATGCTAAAGATAGTAGTGACAAAATTGCTGATGCAGCAGCAGCAGCAAGATCT
GCACAGCCAACTGGATTTACATACTCTACAACAAAAGTTAGAACGAAATTGCCGTTTCTTCTCAAGCATTCTTTACGTGA
GTACCAACACATTGGCTTAGACTGGCTTGTCACGATGTATGAGAAAAGGTTGAATGGGATTTTAGCTGATGAAATGGGTC
TTGGAAAGACGATCATGACCATCGCTCTTCTCGCACATCTTGCTTGTGATAAGGGGATATGGGGTCCCCATCTGATCGTG
GTTCCAACAAGTGTGATGCTTAATTGGGAAACTGAGTTTCTTAAATGGTGTCCTGCATTCAAAATCCTCACCTACTTTGG
GAGTGCAAAGGAGCGAAAACTCAAGAGACAAGGATGGATGAAGCTGAACTCCTTTCATGTATGCATAACAACCTATAGGC
TAGTTATCCAGGACAGTAAAATGTTCAAGCGCAAGAAGTGGAAGTACTTGATTCTTGACGAAGCCCATTTAATTAAGAAC
TGGAAGTCTCAGAGATGGCAAACTCTGTTAAACTTCAATTCTAAACGCAGAATTTTGTTGACTGGTACACCGCTACAGAA
TGATCTTATGGAATTGTGGTCACTGATGCATTTTCTGATGCCACATGTCTTTCAGTCTCACCAGGAGTTCAAAGATTGGT
TCTGTAACCCGATAGCAGGGATGGTGGAGGGCCAAGATAAAATCAACAGAGAAGTTATTGATCGCTTGCATAATGTCCTC
CGTCCTTTCCTTCTACGACGCCTTAAAAGAGATGTAGAAAAACAACTTCCTCAGAAGCATGAGCATGTTATTTTCTGCAG
ATTGTCTAAGAGGCAGCGCAACTTGTATGAGGACTTCATAGCAAGCACAGAAACACAGGCTACGCTTAACAGCGGAAGCT
TTTTTGGGATGATAAGTATCATAATGCAACTGCGGAAAGTTTGTAATCATCCTGATCTCTTTGAGGGGCGGCCTATTGTA
AGCTCTTTTGATATGCCTGGCATTGATGTGCAGTTGAGTTCGAGAATCTGCTCTCTGCTTTTGAAAAGTCCATTTTCCAG
AGTCGATCTTGAAGATCTGGGATTCGTATTCACCCATCATGATTTTTCTATGACTGCTTGGGAAGGGGATGAGATCAAGG
CTATTTCAACGCCCTCCGATTTGATCAAGCAGCGGGTGGACTTGAAGGATAATCCAGAAGAAGTTCCTCTGAGTTTAGTA
AACCGCAAAAATCTGCAAGGGACAAGTATTTTTGAAGAAATTCGTAAGGCCGTCTTTGAGGAAAGGGTTAAAGAATCGAA
GGATCGGGCAGCAGCCATTGCATGGTGGAATTCTTTGAGATGCCGGAGAAAGCCTACTTACTCTACATCTTTAAGAACTC
TTCTAACCATTAAGGGTCCTCTTGATGATATACGCCATCTCAAAGCTAATCGTCCATCTTACATGTACTCCTCAATGCTC
GCTGACATAGTTCTTTCACCGATCGAGCGTTTTCAGAAGGTAATTGAGCTAGTCGAAGCTTTCACGTTTGCGATTCCTGC
TGCAAGAGTGCCTTCACCTGCTTGCTGGTGCAGCAAAAGTGACTCTCCTATTTTTCTTAGTCCATCGTACAAGGAGAAAG
TTACAGATCTATTGTCACCTCTTCTGTCTCCGATTAGACCTGCGATTGTTAGGAGACAAGTATATTTTCCAGATAGGCGG
CTGATACAGTTTGACTGTGGTAAACTGCAGGAGCTTGCTATGCTACTGAGAAAATTAAAATTTGGGGGTCACAGAGCGTT
GATATTCACGCAAATGACCAAGATGCTTGACATCTTGGAGGCTTTCATTAGTTTATACGGTTATACCTACATGCGTCTTG
ACGGTTCTACTCCACCAGAAGAGAGGCAGACATTAATGCAGCGGTTTAACACAAATCCCAAGATTTTTCTCTTCATCTTG
TCAACCCGAAGTGGGGGTGTAGGCATAAACCTTGTTGGTGCAGACACAGTAATCTTCTATGACAGTGACTGGAATCCCGC
AATGGATCAACAAGCTCAAGATCGCTGCCACAGGATTGGTCAGACACGGGAAGTGCATATTTATCGGTTAATAAGTGAGA
GCACCATTGAAGAGAATATCTTGAAGAAGGCAAACCAGAAGCGTGCGCTTGATAACCTAGTTATTCAGAATGGTGAATAT
AACACCGAGTTTTTCAAGAAGCTCGACCCAATGGAATTGTTCTCTGGGCATAAAACTCTGACTAGGAAGGATGAAGAAGA
AAAGAGCAAGAATTGTGAGGCGGAGCTCTCTCTGTCAAACGCAGATGTCGAGGCTGCTTTAAAACATGCAGAAGATGAAG
CAGATTATATGGCTCTCAAAAGAGTAGAAGAAGAAGAAGCTGTGGAGAATCAAGAGTTTACAGAAGAACCTATAGAGAGA
CCAGAAGACGATGAGCTAGTAAATGAGGATGACATTAAGTCTGATGAGCCTGCTGATCAAGGTGTAGCTGCAGCTGGTTC
GGCTAAAGAAGAAGTTTCATTGGTACCTATTGATAACAGGGATGAGAGAGATGACATCATTACTTTAAGCCAAGAAGAAG
ATAATGATGTACCAGATGATGTCAAGCAAATGGCTGCAGCAGCCGCTGCTGCTGGACAAGCTATCTCATCTTTTGAGAAC
CAGCTGCGTCCTATTGATAGATATGCGATTAGATTTTTAGAGGTTTGGGACCCCATCATTGTTGAGGCTGCTATTGAAAA
TGAAGCGGGATTTGAAGAGAAAGAATGGGAACTTGACCACATTGAGAAGTACAAGGAGGAAATGGAAGCTGAAATTGATG
ATGGTGAAGAGCCTCTTGTTTATGAGAAATGGGACGCTGATTTTGCAACAGAGGCATACAGGCAGCAAGTTGAAGTTTTA
ACTCAGCACCAGTTGATGGAAGATCTAGAAAATGAAGCTAGAGAGAGGGAGGCTGCAGAAGAGGCTGAAAGGCGTTTGGC
ACTGAACGAAAGTGCCCATGTACTTAAACCTAAGAAGAAGAAAAAGGTGAAGAAAGCCAAATATAAATCCCTGAAAAAAG
GATCACTCGGGTCCGAGTCAAAACAAGCAAAGACAGTGGTGAAAGTTGAAGCTTCGAGTGATGAAGACAATGAAGAATGC
GGATATGTGAGTAGCAGTGACTCAGACATGGTCTCACCACGTTTGCAGAAACGTATGAAAGGCAAGAAAAGAGAATTAGT
CTTCGACAGTGATGAAGAGAAGAACTCGAAGAAGAAAGCAAAGAAGCATAAGAAGTCTCTTTCACATTCAGATATCAAAT
GCAAGACTCCGCATGATGAGCTGGTTCCATCAAAGCCGTCTGACAGTATGGCTGTTGATAATGAACTGAAACCCGCAAAC
AGGGGTAAAACCCTAGGGAAAAAATTCATCATTTCTATGCCAATAAAGCGTGTTCTTATGATCAAGCCAGAGAAATTGAA
GAAAGGAAATCTCTGGTCTAGAGACTGTGTTCCCTCGCCTGATTCTTGGTTGCCTCAGGAAGATGCTGTATTGTGTGCTA
TGGTTCATGAATATGGGTCTAACTGGAGTTTAGTTAGCGAGACTCTTTACGGAATGACTGCTGGTGGAGCTTACAGAGGA
AGGCATCGCCATCCTGCATATTGTTGTGAGAGATATAGGGAGCTTATGCAGCGACATGTTTTGTCTGCTTCCGACAGTGT
AGTGAACGAAAAGAACCTCAACGCTGGTTCTGGGAAGGCTCTCCTTAAAGTAACTGAGGAAAATATGCGGGCACTTCTAA
ATATTGCAGCTGAGCAGCCAGATACGGAGATGCTCCTTCAAAAACACTTTACTTGCTTGCTGTCTTCAATTTGGAGGACG
TCAACACGCTCTACAAACAATCAAAAGCTCTCCTTAAATAGTCCCATATTCAATAGACAGGTTATGGGTTCTGCGAATCA
CGCTCAAGAATTAGCGAGAAAACCTTTTCAGGGGATGAAGATCACCAGCTTAAGTAGCAAGTTGGTAGAATCCGCTCTCC
AGGACTCGAGCACGAGTCAGCCAGTCGATACTGCTTCTCGTTCTAGATTACAGGAGGATCAACCTATCAATAAAGTGGGA
TTAGACCTAACCTTGGAGTTCCCACGTGGCAATGATGATTCCTCGACTCATTTCCCACCCATCATAAAGCTAACTATTGA
TGGATCAGATTCATTCAATTATGTGAATGACCCTCCAGGGGAAGATAAGCTCAAAGTATCTCGGATTGCTGCAGAGGACC
GTTACAGGAATGCTGCAAATGCGTGTATTGAAGATTCATTTGGATGGGCTTCAAACACGTTCCCCGCATATGATCCAAAG
TCGAGAAGTGGAGTGAAAGCACCGTCTCTGGGGAAGCACAAGCTATCCGCCTCAGACACACCCAAGTCCTCAAAGAGCAA
ACAGCGAAAACTCTCAGCAGCAGAACAATCGGAAGTGGCATGGGTGAGGCGAAATGATCCTAACCTCAAGTTCGATTTTA
CACCTGCGGATAGGGAAGAGGAGGAAGAGGATAAGGAGGTTTCAGAAGAGATAGAGATGATAGGTTGTCCACATTGGTAT
GATCCCTTGTTAACCTCAGGCCTTGATGATTGCTCATTAGCGTCTGAACCCTCAGGAATAGAGTAG