Details for Chinese cabbage Locus Brara.E02820

Position : A05 ( 5`- 24282628 .. 24283161 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02820

Protein [Map View]
MEFSSIIAKLLLLTTLVTTLVISRANEELMMQLCHNSDNPTLCLRCLSSDPTAPKADHVELARIILRCVNSHLITLTNNT
STLAPKHRRDPKAAAALKQCGLGYATAKRGVGKVDAHLIAGDYDKAAYDVSMTVEAPPVSCRASLVTLNFNLPSSFRYHT
EVYLALTQALLRIIDRF*

DNA
ATGGAGTTTTCCTCTATTATAGCAAAGCTTCTTCTCCTCACCACACTTGTTACCACATTGGTTATCTCCAGAGCTAACGA
AGAGCTGATGATGCAACTATGTCACAACTCCGACAACCCCACCTTGTGTCTTCGCTGTCTGAGCTCAGACCCAACTGCTC
CAAAAGCCGACCATGTCGAACTGGCTCGCATCATCCTCAGATGCGTCAACTCTCACCTCATCACCCTCACCAACAACACT
TCCACTTTGGCCCCGAAGCACCGCCGGGATCCTAAAGCTGCAGCCGCCTTGAAACAATGTGGTTTGGGTTACGCGACGGC
AAAGCGTGGCGTGGGAAAGGTCGACGCTCACTTGATAGCCGGAGATTACGACAAGGCTGCGTATGACGTCAGCATGACGG
TGGAGGCTCCTCCGGTCTCGTGCCGTGCCAGTCTCGTGACCCTTAATTTTAATTTGCCCTCGAGTTTCCGTTACCATACA
GAGGTTTACTTGGCGTTAACTCAAGCTCTGCTCAGGATCATTGATCGCTTCTAG